KEGG   Aliivibrio fischeri ES114: VF_0480Help
Entry
VF_0480           CDS       T00236                                 

Gene name
folP
Definition
(RefSeq) 7,8-dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00790  Folate biosynthesis
vfi01100  Metabolic pathways
Module
vfi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VF_0480 (folP)
Enzymes [BR:vfi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     VF_0480 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-GeneID: 3277321
NCBI-ProteinID: YP_203863
UniProt: Q5E7M1
Structure
PDB: 

Position
I:516129..516965
Genome map
AA seq 278 aa AA seqDB search
MKLISKNKSLLLDRSHVMGILNVTPDSFSDGGQFTHLDAALKQAEKMVKAGVSFIDIGGE
STRPGAPEVSLQEELDRVLPIIEAIHQRFDTWISIDTSKAVVMEEAVKVGADLINDVRAL
QEPNALKVAAEANVPVCLMHMQGQPRTMQTNPSYQDLFTDISSFLSERIDACQSVGIAKD
KLILDPGFGFGKTLAHNYQLLAELERFHQFGLPLLAGMSRKSMVFKLLDVEPKMALSGSL
ACATIAAMKGAQIIRVHDFEQTMDIVKVCQATLEQSPH
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaataagtaaaaataaatcccttttattagatcgctctcatgtcatgggaata
cttaacgtaacacctgactctttttctgacggtggccagtttacccatttagatgcggcg
cttaagcaagccgaaaaaatggttaaagctggagtaagttttattgatattggtggcgag
tcaacgcgacctggagcccctgaagtatcattacaagaagagctagatagagtattacca
atcatcgaagccatccatcaacgttttgatacttggatatctattgatacaagtaaagct
gttgttatggaagaggcagtaaaagttggtgctgatttaattaatgatgtgagagcacta
caagagccaaatgctttgaaagtcgcagcagaagcgaatgttcctgtttgtttgatgcat
atgcaagggcaacctcgaactatgcaaactaatccttcttatcaagacttatttaccgac
atctcgagctttttaagtgaaagaatcgatgcatgccaatcggttggtatcgcaaaagat
aagttaattctcgatcctggatttggttttggtaaaaccttggcgcataattaccagctt
cttgctgagctagagcgttttcatcaattcggtttaccgcttctcgctggaatgtcgaga
aaatcgatggtttttaagttactagatgtagagccgaaaatggcactatctggtagcttg
gcttgtgcaacgattgcagccatgaaaggggcgcaaattattcgtgttcatgattttgaa
caaacgatggatatcgtaaaggtttgccaagcaactttagagcaatctcctcattaa

DBGET integrated database retrieval system