KEGG   Aliivibrio fischeri ES114: VF_0740Help
Entry
VF_0740           CDS       T00236                                 

Gene name
proB
Definition
(RefSeq) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00330  Arginine and proline metabolism
vfi00332  Carbapenem biosynthesis
vfi01100  Metabolic pathways
vfi01130  Biosynthesis of antibiotics
vfi01230  Biosynthesis of amino acids
Module
vfi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VF_0740 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    VF_0740 (proB)
Enzymes [BR:vfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     VF_0740 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF4072
Motif
Other DBs
NCBI-GeneID: 3277856
NCBI-ProteinID: YP_204123
UniProt: Q5E6W1
Position
I:807361..808470
Genome map
AA seq 369 aa AA seqDB search
MNTQSQTIVVKLGTSVLTGGTLKLDRAHMVELVRQCVQLKKAGHQVIVVTSGAIAAGREH
LNYPELPKTMANKQLLAAVGQSCLIQAWQSLFGIYGVDVGQMLLTRADLDDRERYLNARD
MLQALLKNNIVPIVNENDAVATNEIKVGDNDNLSALVGILAGADKLLLLTDQSGLFTADP
RKDPKAELIKEVHTIDETLRKIAGGSGTTLGTGGMATKLQAADVARRAGIEVIIAAGSAE
NVITDVVNSKPQGTKFLPVECALESRKRWILAGPPSKGSIVIDEGAVNAVQQKGSSLLSK
GITEVSGHFVRGGVAKIVNTKGELIARGISRYSSDDLSKILGKHSQDIYAVLGYEYGPVA
IHRDDLVLI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
ttgaatacacaatctcaaaccatagtcgttaaacttggtacaagtgtactcaccggtggc
acattaaaattagatagagcacatatggttgagttagttcgccaatgtgttcagctaaaa
aaagctggccatcaagttattgttgttacgtctggcgcaattgctgctggtcgtgagcat
cttaactaccccgaactacccaaaaccatggctaacaagcagttattagctgctgttggt
caaagttgcttaattcaagcgtggcaaagtttgtttggtatttatggtgttgacgtaggt
caaatgctattaactcgagctgatttggatgaccgtgagcgttatttaaatgcaagagat
atgcttcaagcactattaaaaaataatatcgttcctattgttaatgaaaatgatgcggta
gcaaccaatgaaattaaagttggtgataacgataacctttctgcattagtcggtatttta
gcgggtgcagataaattattattgttaacagaccaatcgggtctatttaccgctgatcca
cgtaaagacccaaaagcagaactgatcaaagaagttcatactatcgatgaaacactacgc
aagatagctggcggaagtggtacaactcttggtaccggtggtatggcgacgaagctgcaa
gctgctgatgtggcgcgccgagcgggtattgaagtaattattgctgctggtagtgctgag
aatgtaattactgatgtggttaactctaaacctcaaggtacgaagttcttacctgttgag
tgtgctttagagagccgtaaacgttggatcttagctgggcctccatcaaaaggtagcatt
gttattgatgaaggcgcagtaaatgcggttcaacaaaaaggcagcagtttattaagtaaa
ggtatcactgaagtatcaggccatttcgttcgtggtggcgtagcgaaaattgtgaataca
aaaggtgaattgattgctcgtggtatttcacgttattcaagtgatgacttatctaagatt
ttaggaaaacacagtcaggatatttacgcagtattaggctacgaatatggccctgtagct
atccatcgtgatgatttagtactgatttag

DBGET integrated database retrieval system