KEGG   Aliivibrio fischeri ES114: VF_0825Help
Entry
VF_0825           CDS       T00236                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00020  Citrate cycle (TCA cycle)
vfi00640  Propanoate metabolism
vfi00660  C5-Branched dibasic acid metabolism
vfi01100  Metabolic pathways
vfi01110  Biosynthesis of secondary metabolites
vfi01120  Microbial metabolism in diverse environments
vfi01130  Biosynthesis of antibiotics
vfi01200  Carbon metabolism
Module
vfi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vfi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VF_0825 (sucC)
   00640 Propanoate metabolism
    VF_0825 (sucC)
   00660 C5-Branched dibasic acid metabolism
    VF_0825 (sucC)
Enzymes [BR:vfi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VF_0825 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 3277451
NCBI-ProteinID: YP_204208
UniProt: Q5E6M6
Position
I:906218..907384
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEFGLPVPEGYACDTPQEAFEAAGRISTAKKVVKCQVHAGGRGKAGGV
ELHDTKEGVKEFAQKWLGKNLVTFQTDANGQPVSKILVEEASNIANELYLGAVVDRASQR
IVFMASTEGGVDIEKIAEETPELIHKAAIDPLVGPQAYQGRELAFKLGLEGDQIKQFVKI
FMGLGNMFAQYDLALLEINPLVVTAEGSLLCLDGKINIDSNAMYRQPKLREMHDPSQEDE
REAHAAQWELNYVALDGSIGCMVNGAGLAMGTMDIVNLHGGQPANFLDVGGGATKERVTE
AFKIILSDSNVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVEVPVVVRLEGNNAPLGSQK
LAESGLNIIAATSLTEAAEKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaagcaaagcagctctttgcagaatttggccttcctgtaccc
gagggttatgcttgcgatacacctcaagaagcttttgaagctgcaggccgtattagcacg
gcgaaaaaagtagttaagtgtcaagtacacgctggtggccgtggtaaagcgggcggtgtt
gaactgcatgacacgaaagaaggcgttaaagaatttgcacaaaaatggctaggtaaaaat
ctagttactttccaaacggatgccaacggccaacctgtatcaaaaattttagttgaagaa
gcatcaaatattgcgaatgaattgtacttaggtgcagttgtcgatcgtgcatcacagcgt
attgtatttatggcatcgactgaaggtggcgttgatattgaaaaaattgctgaagaaaca
ccagaactgatacataaagcggcgatcgatcctcttgttggccctcaagcataccaaggt
cgtgaactggcattcaaattgggtttagaaggcgatcaaattaagcaatttgttaaaatc
ttcatgggcctaggtaacatgtttgctcagtacgatttagcacttcttgaaatcaaccca
ttagtagttactgctgaaggtagccttctatgtcttgacggcaaaatcaacattgattca
aatgcgatgtaccgtcaacctaagcttcgtgaaatgcacgatccatctcaagaagacgag
cgtgaagcgcatgctgctcagtgggaattaaactacgtagcacttgatggcagcattggc
tgtatggttaatggtgcgggtcttgcgatgggtacgatggatatcgtaaatctacacggt
ggccaaccagctaacttccttgatgtaggtggtggtgcaacaaaagagcgtgtaactgaa
gcgttcaaaattattttatcagacagtaatgttaaagcggttctagtaaacatctttggt
ggtattgttcgttgtgatctaattgcagatggcatcattggtgctgttgaagaagtgggt
gttgaagttcctgttgttgttcgccttgaaggtaacaacgcaccactaggttcacaaaaa
ctggctgaaagtggcctaaatatcattgcggctacttcattaactgaagcggctgaaaaa
gttgttgctgcagcggagggcaaataa

DBGET integrated database retrieval system