KEGG   Aliivibrio fischeri ES114: VF_0993
Entry
VF_0993           CDS       T00236                                 

Gene name
icmF
Definition
(RefSeq) secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vfi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VF_0993 (icmF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vfi02044]
    VF_0993 (icmF)
Secretion system [BR:vfi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VF_0993 (icmF)
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C MMR_HSR1 Aminotran_5
Other DBs
NCBI-GeneID: 3277512
NCBI-ProteinID: YP_204376
UniProt: Q5E658
Position
I:complement(1092603..1096124)
AA seq 1173 aa
MKSFFNSLLNTLKKTWCWSLLLTLFIALLLCLFGKHIAIANTPLIETTTGKTLTIIICLL
LWGAFNLTLWGLAKREAQKEENKEAYEAAQSEMAFIREHSTILKTKLEAAIATIKRAGLY
GKLNNNVKYQLPWYMVIGPQNSGKTTLLECSGLDFPLNQTDGHYTRDIQNSQHCEWYFAN
HAVLLDAAGRFFDQHENELSKPIWGNFLKALRNKRRRRPLNGVILTIDITTLQSPDESAI
EVQARYVRERLQELRHDLSSDMPIYFLLTKMDKVEGFEPFFSSLSREEMDQVFGVTFNEG
EGQQADKIKHEFEKLILRIDSQVMSRLHDERDVMKRAELLQFPRQLSFLAERLALFSELA
FTKTRYHQASHLRGLYLTSVPEPTNTQTESTTSGIGQNLGISSRVLPTYKHQRGFFIRKL
LEDVIFPNSELATLDEKYEKQVKLKNMAVYAASFALVIGFGSLWATSFLTNHHKQQELLS
LSGDYNQQIVHLSPLAPSIELLPTLNTLLAATQVYSKESETLTDEFAGLQQGDKLRKAAE
AAYHRSLLSLLLPKVTSELEYQVANNQDNREFLTPSLRAYLMLNLHEHLDKAYLEQWMGL
HWSYLYSGSATEQKELQAHFSNLLNIEFEPVQLNDNLIAKSRKFLREADTSELVYQQLKQ
DAKEMDLRDIKISDHLGPNQNLFNHTNTIIPGLYTQKGYKAVFLSKGLDQVKQLIEENWV
IGLSSDLSANEIRGLYADVEDLYFHDYIKYWKEAVDQLQIKPSKNMDEAILQISNITGSS
QPILKLLNLVKENTTFVDKAQVASKTAGQVKKLPVNTKLKKVASLGLHSVEERSQSARKA
VSNQFESLNLLLTDKDQATIPLEDALVVINELSGRLSMVKFSPNPDSSAFKIARDRMQGI
PNELNDIRVMAETLPQPLQQWWKQISNNAWGIILNHSRKHVQIVYHDKVVTHYDVALSGR
YPFRNSSHDVNIADFDEFFQNGGILDNFFDAYLSSFVYKQKGKFKQKSLHGRSLGLSDSF
LDQYNYGLTIQRMFYGSKGKEANVSFRIAPFELDASALQSTFYYGKNKFAYRHGPIQKKQ
FTWPITNQRQYVSFVLQDLSGSKVVNQQNSGPWAFFRVLDKFRVNKYRGQDVIKVDLENK
GMKAKYLIYSDRTPNPFNRKILTNFYLPKRING
NT seq 3522 nt   +upstreamnt  +downstreamnt
atgaaatcattttttaattcattgcttaacacattaaaaaagacatggtgttggagctta
ttattaacactatttattgccttattattgtgtttatttggtaagcatattgcgatagca
aataccccattaattgaaacgactaccgggaaaacattaacaattatcatttgcttacta
ctatggggagcattcaatctgactttgtggggcttagcaaagcgagaagcacaaaaagaa
gaaaataaagaagcgtatgaagctgcgcaatctgaaatggcttttattcgtgaacacagc
accattctaaaaacaaaacttgaagctgcaattgcaacaatcaagcgtgctgggctatat
ggaaaactcaataataacgttaaatatcaacttccttggtatatggttattggcccacaa
aatagtggtaaaacaacccttttagagtgttcaggattagatttccctttaaaccaaact
gatgggcattacacaagagacattcaaaatagccaacattgtgaatggtattttgctaac
catgccgttcttttagatgctgcaggacgcttttttgatcaacatgaaaatgagttaagt
aaaccaatttggggcaattttttaaaagctctacgcaataagcgtcgccgtcgcccatta
aatggggtcatactaactattgatatcacaacattacaatctccagatgaaagcgcaatc
gaagttcaagctcgctatgtacgtgaacgcttacaagagttaagacatgatttaagctca
gatatgcctatctatttcttattaacgaaaatggataaagtcgagggattcgaacccttc
ttctcttccctatccagagaagaaatggaccaagtttttggcgtcacttttaacgaaggt
gaaggccagcaagccgataaaattaaacatgagttcgaaaagctcattttacgtatcgat
tcacaagtcatgtcacgcttacacgatgagcgtgatgtgatgaaacgtgcagaactatta
caattcccacgccaattaagcttccttgctgaacgcttagcgttattttctgaattagcc
tttactaaaacccgttatcaccaagcctctcatttacgtggtttatacctaacgtcagta
cccgaaccaacaaatacccagactgaatcaaccacgtcaggtattgggcaaaaccttggt
atcagctctcgagttcttcctacttataaacatcaacgtgggttctttattcgaaaatta
cttgaagacgtgatttttccaaacagtgaactcgctacattagatgaaaaatatgagaaa
caagtaaaactgaaaaacatggcggtctatgcagcctcttttgctcttgtgattgggttt
ggttcattatgggcaaccagctttttaaccaatcatcataaacaacaagagttattgtct
ctttctggcgattataatcaacagattgtccatttatcccctttagctccttctattgaa
ttactgccaacattaaatactttattagcagcaactcaagtgtattcaaaagagagtgaa
accctcacagatgagtttgcgggactccaacaaggagataaattacgaaaggcagcagaa
gccgcataccacagaagtttactcagtttactgcttcctaaagtaacaagtgaactcgaa
taccaagtggcaaataatcaagataatagagaattcttaacgccttctttacgagcatat
ttgatgctaaatctacatgagcaccttgataaagcttatctagaacaatggatgggattg
cattggtcgtatttatacagtggttcagcaacagagcagaaagagcttcaagcgcatttt
tctaatctattaaatatcgaatttgaaccagttcaattaaacgataatttaatcgctaaa
tctcgtaaatttttacgtgaagcagatacatcagaattggtataccaacagctaaaacaa
gacgcaaaagagatggatctgcgcgatataaaaatcagtgaccatttaggaccaaaccaa
aacttattcaaccacaccaataccattattcctggtttatatacgcaaaaaggatataaa
gctgtctttttaagcaaaggattagaccaagtaaaacaactgattgaagaaaactgggtc
attgggttatcaagtgatttaagtgctaatgagatccgtggactatacgcagatgtcgaa
gacctctatttccatgattacattaaatattggaaagaagcggtagatcaacttcaaatt
aaaccatctaaaaacatggatgaagccattcttcaaatttcaaatattaccggttcaagc
caaccaattttaaagcttttaaacctagtaaaagaaaacaccacctttgttgataaggct
caagtggcttcaaaaactgcaggtcaggttaagaaactacctgtaaatacgaaactgaag
aaagtcgcctctctgggcttacacagtgtcgaagaacgctctcaaagcgctcgtaaagcg
gtaagcaatcaatttgaatcactgaacctattactcacagataaagatcaagcaacgatt
ccattagaagatgcgctggttgtgatcaacgaactgagtggacgattatctatggtgaag
ttctcacctaaccctgattcatcagcctttaagattgctcgcgatcgcatgcaaggaata
ccaaatgagttaaatgatatacgtgtaatggcagaaacgcttccccaaccattacagcaa
tggtggaaacaaatatcaaataacgcttggggtattatactgaaccattcaagaaaacat
gtacaaatagtttaccatgataaagtcgttactcattacgatgtcgctttatcaggtcga
tacccatttagaaacagtagccatgatgtaaacattgctgactttgatgaattcttccag
aacggcggtattttagacaatttctttgacgcctatttatcctcatttgtttataaacaa
aaagggaaattcaaacaaaagtccttacacggacgttcattagggctatctgattcattc
ttagaccaatataactatgggttgactatccaacgtatgttttatggttcaaaaggaaaa
gaagccaacgtctcgttccgtattgcgccatttgaacttgatgcaagcgctttgcaatcc
actttctattacggaaaaaacaaatttgcttaccgtcatggtccaatacagaaaaaacaa
tttacgtggccaataaccaatcagcgtcaatacgtcagttttgttttacaagatctgagt
ggttctaaagtcgtaaaccaacaaaactcaggtccttgggctttcttccgagtattagac
aaattcagagtcaataaataccgaggtcaagatgtcataaaagtagatctggaaaataaa
ggaatgaaagccaaataccttatttatagtgatcgaacccctaatccttttaatagaaaa
atattaacgaatttctatcttccaaaaaggattaatggatga

DBGET integrated database retrieval system