KEGG   Aliivibrio fischeri ES114: VF_1029Help
Entry
VF_1029           CDS       T00236                                 

Gene name
trpC
Definition
(RefSeq) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vfi01100  Metabolic pathways
vfi01110  Biosynthesis of secondary metabolites
vfi01130  Biosynthesis of antibiotics
vfi01230  Biosynthesis of amino acids
Module
vfi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VF_1029 (trpC)
Enzymes [BR:vfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VF_1029 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     VF_1029 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C Eco57I
Motif
Other DBs
NCBI-GeneID: 3277534
NCBI-ProteinID: YP_204412
UniProt: Q5E622
Position
I:complement(1133692..1135104)
Genome map
AA seq 470 aa AA seqDB search
MTQQLSEHISVENTKMAEVLVKIVKDKAIWVEERKKQQPLDDFQSSLSLSDRSFYDALKT
GKTEFILECKKASPSKGLIRDDFDLNYIASVYNNHASAISVLTDEKYFQGNFDFLPIIRN
QVSQPILCKDFMIDAYQVYLARHYSADAILLMLSVLDDAQYKELADIAHSLNMGILTEVS
NEEELHRAVALNAKVIGINNRNLRDLSTDLNRTKELAPLLPKGTTIISESGIYTHQQVKD
LAQHASGFLIGSSLMAEKNLELAARKVILGENKVCGLTSEQDAKAVYDSGAVYGGLIFVE
KSPRFVSFETAKKITQATALHYVGVFQNEDVQRVAQYATDLSLSVIQLHGNETEEYITEL
ASLLPTHTQIWNVISVSDDAQSISLPQTQADKVLVDCKVGSQVGGTGVSFDWNKLPHHSI
MLAGGLELNNTKQAAQLGCYGLDFNSGVESTPGKKDHKKLSAVFSALRDY
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcaattgtctgaacacatctcagtagaaaatacaaaaatggctgaagtgctt
gtaaaaatagtaaaagacaaagccatttgggtcgaagagcgtaagaaacaacaacctctc
gatgattttcaatcgtcattaagtctatctgaccgtagcttttacgacgcattaaaaaca
ggcaaaaccgaatttatccttgaatgtaaaaaagcctcaccatcaaaaggattaattcga
gatgatttcgatctcaattacattgcttctgtctacaataatcacgcgagtgccatttct
gtactaactgatgaaaagtatttccaaggtaactttgatttcttacctattattcgaaat
caagtgtcacagcctattttatgtaaagatttcatgatagatgcttatcaagtgtatctt
gctcgtcattactctgctgatgccattttattaatgctttctgttttagatgatgcgcag
tacaaagaacttgcagacatagcacattcattaaacatgggtattttaacggaagtcagc
aatgaagaagaattgcatcgtgcagtggcattaaacgcaaaagtcattggaattaacaac
cgtaacctacgtgacttatcaacagatttaaatagaacaaaagaactagctcctctactg
cctaaaggtacaaccattatttctgagtcaggtatttatactcatcaacaagtaaaagat
ctggctcagcacgcttcaggctttctgattggtagctcactaatggcagaaaaaaaccta
gagcttgcagcaagaaaagttattttaggtgaaaacaaagtctgtggattaacttcagag
caagatgcgaaagccgtttatgactctggagctgtctacggcggacttattttcgtagaa
aaatcaccacgttttgtttcttttgaaaccgcaaagaaaataacccaagcaactgcatta
cattatgtgggcgttttccaaaatgaggatgttcagcgtgttgctcagtacgccactgac
ctttctctatctgtgattcaactgcatggaaatgaaaccgaagagtatattactgagtta
gcctctttattaccgactcacactcaaatttggaatgtcatttctgtgtcagatgatgct
caaagcatttcacttccacaaactcaagctgataaggtgttagttgattgtaaagtaggt
tcgcaggtgggaggcactggcgtaagttttgattggaataaactgcctcaccacagcatc
atgcttgccggtggacttgaattaaataataccaaacaagcagcgcaactcggctgctac
ggattagatttcaactcaggagtagaaagtactccgggtaaaaaagatcataaaaaatta
agcgccgtatttagcgcattacgagactattaa

DBGET integrated database retrieval system