KEGG   Aliivibrio fischeri ES114: VF_1542Help
Entry
VF_1542           CDS       T00236                                 

Definition
(RefSeq) acetyltransferase
Organism
vfi  Aliivibrio fischeri ES114
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_4 Acetyltransf_15 Acetyltransf_9 FR47 Acetyltransf_CG NMT Acetyltransf_13
Motif
Other DBs
NCBI-GeneID: 3278933
NCBI-ProteinID: YP_204925
UniProt: Q5E4K9
Structure
PDB: 

Position
I:complement(1725849..1726325)
Genome map
AA seq 158 aa AA seqDB search
MAPVIRRAKEIDLYCLNSLMYKLHDEHHQQCPDLFKTASEIEEEKSIARYLDDPECMVYV
AEMDDVIIGFITGHFCELISTVSKLVMMATIDELYIEKEYRREGVAEQLMMRIEQELKDY
GVKEIFVEVWDFNKGALEFYNKQGLNEHIHYLRKPLNR
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggctccagttatccgtcgagcaaaagagattgatctctattgtttaaattcactgatg
tataaattacacgatgaacatcaccaacaatgtccagatttattcaaaacagcttctgaa
attgaagaagagaaaagtatcgctcgatatttagatgatcctgaatgtatggtgtatgtg
gcggaaatggatgacgttattattgggtttattactggtcatttttgcgaattaatttca
acggtgagtaaactagtaatgatggcaaccatagatgaactatatattgaaaaagaatat
cgacgcgaaggtgttgctgagcaattaatgatgcgaatagaacaagaattaaaagattat
ggtgtaaaagagatttttgtagaagtgtgggattttaataaaggggcattggaattctat
aataaacaaggattgaatgagcatattcattatttacgcaagccattgaataggtaa

DBGET integrated database retrieval system