KEGG   Aliivibrio fischeri ES114: VF_1793Help
Entry
VF_1793           CDS       T00236                                 

Gene name
fhs
Definition
(RefSeq) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00670  One carbon pool by folate
vfi01100  Metabolic pathways
vfi01120  Microbial metabolism in diverse environments
vfi01200  Carbon metabolism
Module
vfi_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:vfi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    VF_1793 (fhs)
Enzymes [BR:vfi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     VF_1793 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-GeneID: 3277682
NCBI-ProteinID: YP_205176
UniProt: Q5E3V8
Position
I:2024546..2026294
Genome map
AA seq 582 aa AA seqDB search
MKSDIEICQTATLTRMKTIASNLGLHDDDITPQGPFKAKVNIDALKRLKSEPNGKLILVS
AITPTPLGEGKTVTTIGLAQGLAKLGESVSACIRQPSMGPVFGVKGGAAGGGYSQVAPME
ELNLHLTGDIHAITAAHNLASAAIDARIYHEQRLGYDVFSEKNELPALRIDPQHVVWKRV
MDHNDRALRMVTIGKNEDGKTINGYEREDGFDITAASELMAILALATDLQDLRQRIGRIV
VAYNLDGEPVTTEDLQVAGAMTVTMKFAINPTLMQTLEGVPTFVHSGPFANIAHGNSSII
ADNIALKLTDYTVTEGGFGSDMGFEKACNIKAPLSEKSPDCAVLVATLRGIKANSGLFPL
SPGQSLPKELFAPNKEALDAGLDNLLWHINNCAKYGLPVVVAINRFPEDTQEELDSLLNW
VSNLDMNVDVAISEAFVKGGNGTLELAEKVIKACQQETQFTPLYTSEMSLFDKLNAVAIK
GYGAERIELSEKAQQQLATFEKLGYQSLSVCMAKTPASISTDGNIKGAPTDFIVPIRELK
LCAGAGFIYALCGNVMTMPGLPEKPAFMNLDIDGDGNIVGLS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgatattgaaatctgccaaactgcgacacttacacgaatgaaaacgattgcg
tcaaacttaggactgcatgatgatgacattactccgcaaggtccatttaaggcaaaagta
aatatcgacgccttaaaacgattaaaatcagaaccaaatggtaaattaattttagtcagc
gccatcactccaacaccacttggtgaaggtaaaacggtaaccactattggccttgctcaa
gggctagctaaattaggtgaatccgtcagtgcttgtattcgacagccatcaatggggccg
gtttttggtgtaaaaggaggtgccgctggcggtggttatagccaagtagctccaatggaa
gagttaaacctacacttaactggtgacattcatgccatcaccgcagcccataacctagct
tctgctgccattgatgctcgtatctatcatgaacagcgtttaggttatgatgttttctca
gaaaagaatgagttacccgctttgcgtattgaccctcaacacgtggtctggaaacgtgta
atggatcacaacgatcgtgctcttcgcatggtaaccattggcaaaaatgaagacggcaaa
accattaatggctatgagcgtgaagatgggtttgatattactgcagcttcagaattaatg
gctatcttagcacttgcaaccgatttacaagacttacgccaacgaattggtcgtattgtt
gttgcttataatttagatggtgaaccagtaacgactgaagatttacaagtcgctggtgca
atgacggtaaccatgaagtttgcgattaatccaacattgatgcagacattggaaggtgta
cctacctttgttcactctggaccatttgcaaatattgcccacggtaactcatcaatcatt
gctgataacatcgctttaaaattaacggattataccgttaccgaaggtggctttggttca
gatatgggattcgaaaaagcctgtaatatcaaagcaccgttatcagaaaaatcaccagat
tgtgcggttctagtcgcaacattacgtggtattaaagccaattcaggcctattccctcta
tcaccaggccaatcgctacctaaagaattatttgctccaaataaagaagcattagatgcg
ggtcttgataacttattatggcacatcaataactgtgctaaatacggtttgcctgtcgtt
gtcgctattaaccgattcccggaagacactcaagaagaactagattcattattaaattgg
gtttctaatttagacatgaatgtcgatgtagcaattagcgaagcgtttgttaaaggcggg
aacggcacattagagttagctgaaaaagtaattaaagcgtgtcaacaagagacacaattt
actcctttatatacttctgagatgagcctattcgataaacttaatgctgtagcaataaaa
ggttatggcgctgaacgaattgaattatcagaaaaagcccaacaacaattagcgacattt
gaaaaattaggttaccaatcattatctgtctgtatggcaaaaacacctgcttctatttct
acagatggaaatatcaaaggtgcgccaacggattttattgtgcctatcagagaattaaaa
ctctgtgcaggtgctggctttatctatgcattatgcggaaatgtaatgacaatgccaggg
ttaccagaaaagccagcattcatgaatttggacattgatggcgatggtaacatcgttgga
ttaagctaa

DBGET integrated database retrieval system