KEGG   Aliivibrio fischeri ES114: VF_2204Help
Entry
VF_2204           CDS       T00236                                 

Gene name
mraY
Definition
(RefSeq) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00550  Peptidoglycan biosynthesis
vfi01100  Metabolic pathways
vfi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vfi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VF_2204 (mraY)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    VF_2204 (mraY)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vfi01011]
    VF_2204 (mraY)
Enzymes [BR:vfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     VF_2204 (mraY)
Peptidoglycan biosynthesis and degradation proteins [BR:vfi01011]
 Precursor biosynthesis
  Glycosyltransferase
   VF_2204 (mraY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4 MraY_sig1 Ndc1_Nup
Motif
Other DBs
NCBI-GeneID: 3279420
NCBI-ProteinID: YP_205587
UniProt: Q5E2P7
Position
I:complement(2476223..2477305)
Genome map
AA seq 360 aa AA seqDB search
MIIWLSNFLEQYFPFFRLFEYLSFRAILSIITALTISLWMGPKLIAWLQNLQIGQVVRDD
GPESHFSKRGTPTMGGIMILTAITVTVFLWADLTNPYVWAVMFVLLGYGAVGFVDDYRKV
VRKNTDGLIARWKYFWQSSIALVVAFALYAYGKDTAATQLVVPFFKEVMPQLGLAYILLT
YFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFAFIAWATGNVQFANYLHIPHIPLASELV
VVCAAIVGAGFGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFLLVIMGGVFVVE
TLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISMLLVLIALATLKVR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgattatttggttatccaattttctagagcaatattttccattttttcgcttatttgaa
tatttaagttttagagccatcttaagcattatcacggcattaacgatctctttatggatg
ggaccaaaactgattgcttggttgcaaaaccttcaaattggtcaagtggtacgtgatgac
ggtcctgaatcacattttagtaagcgtggtacgccaacgatgggcggcatcatgatttta
actgcaattacagtgacagtgttcttgtgggcagatttaactaacccttatgtatgggct
gttatgtttgtactactaggctatggtgctgttggctttgttgatgactaccgtaaagtt
gttcgtaaaaatacagatggtctaatcgctcgttggaagtatttttggcaatcttctatt
gcgttagttgtcgcttttgctctttatgcttacggaaaagatacggcagcaacgcagtta
gttgttcctttctttaaagaagtaatgcctcaacttggtcttgcttatattcttcttacc
tactttgttatcgtaggaaccagtaatgcggtgaacttaaccgatggtcttgatggtctt
gcaatcatgcctacggtatttgttgctgcaggttttgcctttattgcttgggcaacaggt
aacgtgcaattcgcaaactacttacatattccgcatattccgttagcgagtgagttagtg
gttgtgtgtgctgcgattgttggtgctggttttggtttcttatggttcaacacgtatcca
gcacaagtatttatgggtgatgtaggttcactggctcttggtggagcactaggtacgatt
gcagtgttagttcgtcaagagttcctattggttatcatgggtggtgtattcgttgttgaa
acgttatcggtaatcttacaagtgggttcatacaaactacgtggtcaacgtattttccgt
atggcaccaattcatcaccattacgaattaaaaggttggccagagcctcgcgttattgtg
cgtttctggattatttctatgttattggttcttattgcattagcgacattgaaggtacgt
taa

DBGET integrated database retrieval system