KEGG   Aliivibrio fischeri ES114: VF_2340Help
Entry
VF_2340           CDS       T00236                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00010  Glycolysis / Gluconeogenesis
vfi00030  Pentose phosphate pathway
vfi00051  Fructose and mannose metabolism
vfi00052  Galactose metabolism
vfi00680  Methane metabolism
vfi01100  Metabolic pathways
vfi01110  Biosynthesis of secondary metabolites
vfi01120  Microbial metabolism in diverse environments
vfi01130  Biosynthesis of antibiotics
vfi01200  Carbon metabolism
vfi01230  Biosynthesis of amino acids
vfi03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VF_2340 (pfkA)
   00030 Pentose phosphate pathway
    VF_2340 (pfkA)
   00051 Fructose and mannose metabolism
    VF_2340 (pfkA)
   00052 Galactose metabolism
    VF_2340 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    VF_2340 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VF_2340 (pfkA)
Enzymes [BR:vfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VF_2340 (pfkA)
Protein phosphatases and associated proteins [BR:vfi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VF_2340 (pfkA)
Messenger RNA biogenesis [BR:vfi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     VF_2340 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-GeneID: 3279348
NCBI-ProteinID: YP_205723
UniProt: Q5E2B1
Position
I:complement(2629060..2630022)
Genome map
AA seq 320 aa AA seqDB search
MVKKIGVLTSGGDAPGMNAAVRGVVRTALTEGLEVFGIHDGYLGLVEDRIEKLERHSVSD
MINRGGTFLGSARFPEFKEVAVREKAIENLKKHDIDALIVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIDAIDRLRDTSSSHQRISIVEVMGRHCGDLTLM
SAIAGGCEYVITPETGLNKEALIQNIQDGIAKGKKHAIIAITELMTDVNQLAKEIEAETG
RETRATVLGHIQRGGQPGAFDRILASRMGNYGVKLLIDGHGGRCVGIQNEQLVHHDIIDA
IENMRRPEKLELYKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagaagattggtgttttaacaagtggtggcgatgcgccgggtatgaatgcggca
gttcgtggtgttgttcgtacagcattgacggaaggcctagaagtatttggtattcatgat
ggctacttaggtcttgttgaagatcgtatcgaaaaattagagcgtcacagcgtatctgat
atgatcaaccgcggcggtacattcttaggttcagcacgttttcctgagtttaaagaagta
gctgttcgtgaaaaagcgatcgaaaaccttaagaaacacgacattgatgcgctaatcgtt
atcggtggtgacggttcttacatgggtgcgaagaaattaactgaaatgggttacccatgt
atcggtcttcctggcacaatcgataatgatatcgcgggtactgactacacaattggttac
ctaacagcattaaacactgttattgatgcaattgaccgtctacgtgacacgtcttcttct
caccaacgtatttctattgtagaagttatgggtcgtcactgtggtgatttaactcttatg
tctgcaattgctggtggttgtgagtacgttattactcctgaaacaggtttaaacaaagaa
gctctgattcaaaatatccaagatggtattgcgaaaggtaaaaaacacgcaatcatcgcg
atcactgagctgatgacagatgttaaccaacttgcaaaagaaatcgaagctgaaacgggt
cgtgaaactcgtgcaacggttcttggtcacattcagcgtggtggtcaacctggtgcattc
gaccgtatcctagcttctcgtatgggtaactatggtgtgaaattgctgattgatggtcac
ggtggccgttgtgttggtattcaaaatgaacaacttgttcaccacgatatcatcgatgca
attgaaaacatgcgtcgtccagaaaaacttgagctatacaaagtagctgaagagttattc
taa

DBGET integrated database retrieval system