KEGG   Aliivibrio fischeri ES114: VF_A0468Help
Entry
VF_A0468          CDS       T00236                                 

Gene name
zwf
Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00030  Pentose phosphate pathway
vfi00480  Glutathione metabolism
vfi01100  Metabolic pathways
vfi01110  Biosynthesis of secondary metabolites
vfi01120  Microbial metabolism in diverse environments
vfi01130  Biosynthesis of antibiotics
vfi01200  Carbon metabolism
Module
vfi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
vfi_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:vfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VF_A0468 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VF_A0468 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vfi04147]
    VF_A0468 (zwf)
Enzymes [BR:vfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     VF_A0468 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     VF_A0468 (zwf)
Exosome [BR:vfi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   VF_A0468 (zwf)
  Exosomal proteins of colorectal cancer cells
   VF_A0468 (zwf)
  Exosomal proteins of bladder cancer cells
   VF_A0468 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N DUF3979
Motif
Other DBs
NCBI-GeneID: 3280207
NCBI-ProteinID: YP_206426
UniProt: Q5E0A8
Position
II:538302..539804
Genome map
AA seq 500 aa AA seqDB search
MTISDNNTIVIFGASGDLTYRKLIPALYHLYASNQLPSTFSILGVSRTQYDDESYREKMK
QSLRELEKTEPEILDAFCHHLHYQALNTSDVDEYSKLVCKLDQLADKYQLEQQNTLFYLA
TPPSLYGVIPSCLAAHGLNDESNGWKRLIIEKPFGYDLASALELGKQIHQYFEEHQIYRI
DHYLGKETVQNLLVLRFSNVMFEPLWNRNFIDYVEITGSEFLGVEERGGYYDGSGAMRDM
FQNHLLQVLAMVGMESPSAINADSMRDEIAKVLQSLQPLTEQDLRNNLVLGQYTESEVRG
QFLPSYRDEQGVADDSRTETYVGLKMFINNWRWNGVPFYVRTGKRLPTRVTEVVVHFKKT
PHPAFAENAPENKLVIRIQPDEGIQMRFGLKEPGSGFNVKDVSMDFHYQSLAETQMLTAY
ERLLLDALNGDATLFARSDAVNACWKFVQPILDFKQDPQALFGYACGTWGPKEADQLLER
DNRKWRFPCKNLTDTDYCEL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttcggacaacaataccatcgtaatttttggcgcttcgggcgatctcacttat
cgaaagttgatcccggctttatatcatttgtatgccagtaaccaacttccttctacgttt
tccattttaggtgtaagccgaactcaatatgatgacgagtcatatagagaaaaaatgaaa
caatcattaagagagttagagaaaacggaacctgaaattttagatgcgttttgtcatcat
ttgcattaccaagcactgaacacatcagatgttgatgaatattcaaaattggtgtgtaaa
ttagaccagcttgctgataaataccaattagaacaacaaaatacacttttttacttggca
acaccgccaagtctttatggtgtgatcccttcgtgtttagccgctcatggattaaatgat
gaatctaatggctggaaacgtttaatcatcgaaaaaccatttggttatgatttggcgtca
gcgctagaacttggtaaacaaattcatcaatattttgaagagcatcaaatatatcgtatt
gaccattatcttggtaaagaaaccgttcaaaacttattagtactgcgtttttcaaatgta
atgtttgaacctctgtggaaccgtaattttattgattatgtcgagatcacaggctctgag
tttcttggagtagaagagcgtggtggttactatgatggctctggtgcaatgcgtgatatg
ttccaaaatcatttgctacaagtattagcaatggttggaatggaatcgccttcagcaatt
aatgcagattcaatgcgtgatgagattgctaaagtattacaaagcctgcagcctctgaca
gagcaagatctacgtaataaccttgtattaggtcaatatactgaatctgaagtaagagga
cagtttttaccaagttatcgtgatgaacagggtgttgctgatgattctcgtactgaaacg
tatgttggcttaaaaatgtttatcaataactggcgatggaatggtgtgccattttatgtc
cgtactggtaaacgccttccaactcgagtgacagaagtggttgtccattttaaaaagacg
ccacatccagcgtttgcagaaaatgctcctgaaaataaattagtgatacgcattcaacct
gacgaaggtattcaaatgcgtttcggcttgaaagagccaggttcaggctttaatgtgaaa
gatgtatcaatggacttccattatcaatcactggcagaaacacaaatgctgacagcttat
gaacgtttgctgttagatgcgttgaatggtgatgctacgttatttgcacgaagtgatgcg
gtaaatgcatgttggaaatttgttcaaccgatactcgattttaaacaagatccacaagcc
ttatttggctatgcatgtggtacttggggaccaaaagaagccgatcaattattggaacgt
gataatagaaaatggcgttttccttgtaagaacttaacagatacggattactgtgaatta
tga

DBGET integrated database retrieval system