KEGG   Aliivibrio fischeri ES114: VF_A0470Help
Entry
VF_A0470          CDS       T00236                                 

Gene name
gnd
Definition
(RefSeq) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00030  Pentose phosphate pathway
vfi00480  Glutathione metabolism
vfi01100  Metabolic pathways
vfi01110  Biosynthesis of secondary metabolites
vfi01120  Microbial metabolism in diverse environments
vfi01130  Biosynthesis of antibiotics
vfi01200  Carbon metabolism
Module
vfi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
vfi_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:vfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VF_A0470 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VF_A0470 (gnd)
Enzymes [BR:vfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     VF_A0470 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     VF_A0470 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored 2-Hacid_dh_C Shikimate_DH 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 3280212
NCBI-ProteinID: YP_206428
UniProt: Q5E0A6
Position
II:540560..542008
Genome map
AA seq 482 aa AA seqDB search
MKGDIGVIGLAVMGQNLILNMNDHGYKVVAHNRTAEKVDEFLQGPAKGTNIVGAYSLQEL
VDKLESPRKIMLMVRAGDVVDSFIDKLVPLLDKGDIIIDGGNTNFPDTNRRVAALKEKGI
HFIGSGVSGGEEGARFGPSIMPGGSPEAWPFVKPIFQAISAKTENNEPCCDWVGNDGAGH
FVKMVHNGIEYGDMQLITEAYQFMKDGLGMTHDEMQSVFIEWNKTELNSYLVEITSDILG
YKDTDGEPLVEKILDTAGQKGTGKWTGINALDMGIPLTLITESVFARCLSSLKDQRVEAE
ELFGKKESIVEGDKQVWIEALRQALLASKIISYAQGFMLMREASNENGWDLNYGNVALMW
RGGCIIRSAFLSNIRDAYDIDPELSFLGSDSYFKGILENSMSAWRKVAAKSMEVGIPMPS
MTSALTFLDGYTTARLPANLLQAQRDYFGAHTYERVDKPKGEFFHTNWTGKGGDVSSTTY
NS
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcgatattggcgtaattggtcttgcagtaatgggccagaacctaattctaaat
atgaacgatcacggttataaagtggtagcacataaccgaactgctgaaaaagtagatgag
ttcttacaaggtcctgcaaaagggacaaatattgttggtgcatattcgcttcaagagtta
gttgataaattagaatcaccacgcaaaattatgttaatggtacgagctggtgatgttgtt
gattcatttatcgacaagttggttcctttattagataaaggtgacatcatcattgatggt
ggtaatacaaatttcccagatactaaccgtcgtgttgctgcgctgaaagagaaaggaatt
cactttattggttctggtgtttctggtggtgaagaaggtgctcgttttggtccttcaatt
atgcctggaggttcacctgaagcatggccatttgttaaaccaattttccaagctatttca
gcgaaaactgaaaataatgagccttgttgtgattgggttggtaacgatggtgctggccac
tttgtaaaaatggttcataacggcattgaatatggcgatatgcagcttatcacagaagca
taccagttcatgaaagacggccttggtatgacgcacgatgaaatgcagtctgtttttatt
gagtggaataaaaccgagctaaatagttatttagtagaaatcacttcagatatcttaggt
tataaagatacagatggtgaaccattagtagaaaaaattcttgatactgctggccaaaaa
ggcacaggtaagtggacaggaattaatgcattagatatgggtatcccattaacgctaatt
acagaatctgtatttgcacgctgtttatcatcattaaaagatcaacgtgtagaggctgaa
gagttatttggtaagaaagaatcgattgttgaaggtgataaacaagtttggatagaagca
ttacgccaagcacttttagcatcgaaaatcatctcatatgcacaaggctttatgttgatg
cgtgaagcgtcaaacgagaatggttgggatctaaattacggtaacgtggcattgatgtgg
cgtggtggttgtattatccgttctgcattcttaagtaatattcgtgatgcgtacgatatt
gatcctgaactttcctttttaggttcagatagctacttcaaaggtattctagaaaatagt
atgtctgcatggagaaaagtagcagcaaaatcaatggaagtagggatcccaatgccatca
atgacatcagcattgactttccttgatggttatacaacagctcgtcttcctgcaaactta
ctgcaagcacaacgtgattattttggtgctcatacttacgagcgtgtagataaaccaaaa
ggtgagtttttccatacgaattggacaggtaaaggcggtgatgtatcatcgacaacgtat
aactcgtag

DBGET integrated database retrieval system