KEGG   Aliivibrio fischeri ES114: VF_A0954
Entry
VF_A0954          CDS       T00236                                 

Definition
(RefSeq) hemolysin co-regulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vfi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VF_A0954
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vfi02044]
    VF_A0954
Secretion system [BR:vfi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VF_A0954
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-GeneID: 3280646
NCBI-ProteinID: YP_206912
UniProt: Q5DYX2
Position
II:complement(1073259..1073777)
AA seq 172 aa
MPTPAYMRIEGEKQGLITAGTFTEDSVGNIYQEGHEDEVLVQGFEHQVLLPRDPQSGQPT
GQRVHKPVRITKVFDKASPLMYNALTSGEKLPKVEIKWYRTSATGTQEHYFTTVLHDAII
VDITASMPNCQDPSQAHFTHLEDVFMTYRAIDWTHEVAGTSGNDDWRTAMKA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccagcttatatgcgcattgaaggcgaaaaacagggactaattactgcaggt
acatttactgaagattcagtaggtaacatttaccaagaaggtcatgaagacgaagtatta
gttcaaggatttgaacatcaggttttattacctcgtgatcctcaatcaggtcagcctact
ggtcaacgtgtgcataagcctgtacgtattacaaaagtattcgataaggcatcaccacta
atgtataacgcattaacgtctggtgagaaactgcctaaagttgagattaagtggtaccgt
acttctgcaacaggtacacaagagcactatttcacaacagttctacacgatgcgattatc
gttgatatcacagcgtcaatgcctaactgtcaagacccatcacaagcgcatttcacacac
ctagaagatgtatttatgacatatcgtgccattgattggacgcacgaagtcgcaggtaca
tcaggtaacgatgactggcgtacagcaatgaaagcgtaa

DBGET integrated database retrieval system