KEGG   Aliivibrio fischeri ES114: VF_B0043Help
Entry
VF_B0043          CDS       T00236                                 

Definition
(RefSeq) VirB11 ATPase
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vfi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VF_B0043
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vfi02044]
    VF_B0043
Enzymes [BR:vfi01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     VF_B0043
Secretion system [BR:vfi02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   VF_B0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSE ABC_tran AAA_7 TrwB_AAD_bind AAA_30 Pox_A32 AAA_19 Zeta_toxin AAA_22 NACHT PRK Mg_chelatase FtsK_SpoIIIE DUF87 TsaE MobB AAA_24 AAA_14 ATP_bind_1 RsgA_GTPase AAA_29 AAA_28 ResIII AAA_23 Sigma54_activat ATPase Microtub_bd KAP_NTPase dNK RNA_helicase
Motif
Other DBs
NCBI-GeneID: 3281037
NCBI-ProteinID: YP_207173
UniProt: Q5DY61
Position
pES100:31621..32628
Genome map
AA seq 335 aa AA seqDB search
MTIGKDTTINHLFKPLNEWLEDEDITEIAINQPNEVWIEKHDQWTSYSCNALSFDHLNSM
ATAVASFCDNNISVSQPILSATLPKGERIQFVIPPACSPNTVSITIRKPNIAQRTLKDYV
RDGFFNHVIPTQQTMSPIDKQLLDLKDTDLSTFLKLAINAQKTIVIAGGTGSGKTTFMKM
LVDLIPKAQRIITIEDVSELFLPNTPNKVHLFYPSEATQSDPVTSAKLLKSCLRMKPDRI
LLAELRGAETFDFVNIAASGHGGSITSCHAGSVALTFERLAAMMMKNPEAISLPYEAIVK
LLHQVIDIVIHIENDVHSDNPIGRHITEVWFKPNE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacaataggcaaagataccaccatcaatcacttatttaagcctcttaatgaatggctt
gaagatgaagacattactgaaattgccatcaatcaaccaaatgaagtgtggattgaaaag
cacgaccaatggacatcttattcttgtaacgcgctttcatttgaccatctcaattcaatg
gcgacagcggtcgcctctttttgtgataacaatatttcagtcagtcagccaattttatca
gcaacgttacccaaaggagaacgtatccaatttgttatacctccagcgtgtagcccgaac
acggtaagcatcaccatacgaaaacctaacattgctcaacgcaccttaaaagattatgta
cgagacggctttttcaatcatgtgatccctactcaacaaacaatgtcccctatcgacaaa
caattattggatctcaaagacacagatctatctacgtttttgaaattagccattaatgct
caaaaaaccattgtgattgcaggagggacaggctcaggtaaaaccacatttatgaagatg
ttagttgacttaattcccaaagctcaacgcattattaccattgaagatgtgtctgaattg
tttctaccaaatacacccaataaggtgcatttgttttacccaagtgaagcaacacaaagc
gatcctgtcacttcagcaaaactacttaaaagctgtttacgcatgaaacccgatcgcatt
ttattagcagaacttcgaggcgcagaaacctttgattttgtgaatatcgcagcatcaggt
catggcggaagcatcaccagttgccacgcaggaagcgtggcactgacctttgagcgatta
gccgccatgatgatgaaaaaccccgaagccatctccttgccttatgaagccatcgtaaaa
ttacttcatcaagtcattgatattgtcatccatatagaaaatgacgttcattcggataat
ccaataggtcgtcatataacagaagtgtggtttaaaccaaatgaataa

DBGET integrated database retrieval system