KEGG   Aliivibrio fischeri ES114: VF_B0044Help
Entry
VF_B0044          CDS       T00236                                 

Definition
(RefSeq) protein VirD4
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vfi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VF_B0044
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vfi02044]
    VF_B0044
Enzymes [BR:vfi01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     VF_B0044
Secretion system [BR:vfi02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   VF_B0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Motif
Other DBs
NCBI-GeneID: 3281031
NCBI-ProteinID: YP_207174
UniProt: Q5DY60
Position
pES100:32705..34531
Genome map
AA seq 608 aa AA seqDB search
MIHSANTEIVTPYTIIEQWIYYSEDMRYQKSLVTALLIGFGIAVIAPTLLFLFNTKEKEE
LHGSARFATQDEIKKEGLTNNNGKGILIGQFNGFLGFFKTYLYFNSDSFILLIAPTRSGK
GVGVVIPNLLVYNQSMVILDLKQENFSITSKYRAKYGQQVFLFNPFTENGQTHRYNPLSY
VREGDCKIGDILTITASFYPIDDLKNSFWNNQASNLFLGLALMISETPSLPFTIGELLRQ
SSGKGKPLKEYLQGIMDDREKSSSPLSESCIDALNRFIALTDNSLSNVLASFNAPLTLWA
NPLFDAATSANDFDLRELRKKKMTVYIGITPDYLEQAERILNLFFSQLININTKELPEHN
PELKYQCLLVMDEFTAMGRIGILAKSVSYMAGYGLRLLTIIQAPSQLDSVYGKEEARTYK
TNHAGQILFAPRENEDAEEYSKAIGYKTVKAKSNSKTRGELKQTDSTSDQRRAVMLPQEI
KEIGMWKEIICIENLKPIFCKKVQYFNDPVFIDRLKEVSSSLKSIEGIPTRDQLKNAITN
KELQIEIPTLERIDSKPTPTLFDSPLNQPLPLSDHDIATVQEEVETEEQYDESLLATTYD
DSDLPDFL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgatccatagtgcaaatacagaaatcgtcacgccctataccatcatagagcaatggata
tattactctgaggacatgcgctatcaaaaatcgcttgtcaccgcattactgattggtttt
ggtattgccgttatcgctcctaccctccttttcctttttaataccaaagaaaaagaagaa
cttcacggctcggctcgttttgcaacgcaagacgagatcaaaaaagaaggcttaacaaac
aataacggtaaagggatcttaatcggtcaatttaatgggttccttggtttttttaaaacc
tatctttattttaatagtgacagtttcatactattaatcgctcccacacgaagcggtaaa
ggggttggcgtcgttattcctaatttactggtttataaccaatcaatggttatattggac
ttaaaacaagaaaacttttctatcacctcaaaatatcgcgctaagtatggccaacaagtc
tttttgtttaatccatttacagaaaatggacaaacacacagatacaacccgttgagttac
gttcgtgaaggtgattgcaaaattggtgatattctcactatcactgcttctttttatcca
atcgatgatctaaaaaatagcttttggaataatcaagccagtaacttatttttagggtta
gccttaatgatctctgaaaccccgtcattaccattcaccatcggtgaactactaaggcaa
tcgtctggaaaaggaaaaccattaaaagaatatttacaaggcataatggatgacagggag
aaatcttcatcccctctttctgaatcttgtatcgatgcactaaaccgcttcatcgcgtta
accgacaacagtttatctaacgtactggcctcatttaatgccccattaacactgtgggcg
aatccattatttgatgctgcgaccagtgccaatgattttgatttacgcgagctaagaaag
aaaaagatgacggtttatattggtattacacctgattacttagaacaagctgagcgcata
ttaaatctgttctttagccaattaattaatatcaataccaaagagctgccagagcacaac
cctgagctgaaatatcaatgcttattggttatggatgaatttaccgcaatgggaaggata
ggcattcttgcaaaatccgtatcttacatggctggttatggccttcgtttattaaccatt
attcaagcaccgtctcaactagacagtgtatatggcaaagaagaagccagaacctataaa
acaaaccatgcaggacaaatcctatttgcaccccgtgaaaatgaagatgctgaggagtat
tcaaaagccatcggttacaaaaccgtaaaggcaaaaagtaactctaagaccaggggagaa
ctgaaacaaacggattcgacatcagatcaacgtagagccgttatgttaccccaagaaatc
aaagagatagggatgtggaaagaaatcatttgtattgaaaatcttaagccaattttttgt
aaaaaagttcagtattttaatgatcccgtctttatcgataggttaaaagaagtctcttca
tccctcaaatcgatagaaggaatacccacacgagatcagttaaaaaacgcgatcacaaat
aaagagcttcaaattgaaataccaacactagagcggattgactctaagccaactccgaca
ttatttgactcaccattaaatcaaccactgccgttatcagatcatgatattgccactgtt
caagaagaagtcgaaacagaagaacaatatgatgaatctcttttagcgacaacatacgat
gattctgacctccctgattttctctaa

DBGET integrated database retrieval system