KEGG   Vibrio fluvialis: AL536_00005Help
Entry
AL536_00005       CDS       T04379                                 

Definition
(GenBank) bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
vfl  Vibrio fluvialis
Pathway
vfl00250  Alanine, aspartate and glutamate metabolism
vfl00330  Arginine and proline metabolism
vfl01100  Metabolic pathways
vfl01110  Biosynthesis of secondary metabolites
vfl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vfl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AL536_00005
   00330 Arginine and proline metabolism
    AL536_00005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vfl03000]
    AL536_00005
Enzymes [BR:vfl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     AL536_00005
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     AL536_00005
Transcription factors [BR:vfl03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    AL536_00005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH Laminin_II
Motif
Other DBs
NCBI-ProteinID: AMF93321
UniProt: A0A0X8LJW7
Position
1:join(1671192..1671895,1..2416)
Genome map
AA seq 1039 aa AA seqDB search
MFTATDVLKAEFVEQPLSKLWSKISPLYMVDESQWLEQLLPLATPSDAEKSSMAVKTTEL
IEAIRKDKKSIQMIDALLLEYSLDTQEGILLMCLAEALMRIPDTETADAFIRDRLGVADW
KSHLKSSDSVFVNASTWGLMLTGKVIGLADAEGTSPIQAVNRLVNKLSEPVIRKAMHQAM
KIMGHQFVLGRTIAEAQKNGRPMRDKGYTYSFDMLGEAALTTADANKYFKDYLMAIEAVG
RDKYGLDTSPAPSVSIKLSALHPRYEVANRDRVMTELYSTLIQLLDRAMELDVAITIDAE
EADRLELSLELFEKVYRSEKVKGWGKFGLVVQAYSKRALPVLVWLTALAKEQGDLIPVRL
VKGAYWDSEIKWSQQSGYTGYPVYTRKEATDVSYLACARFLLSESVRGNLFPQFASHNAQ
TVTAIAVMAQHKDFEFQRLHGMGDALYNHVMAAYKQSVRIYAPVGSHKDLLPYLVRRLLE
NGANSSFVHRLVDARCPISTLTQHPVDMLLAFDTLNNTKIPLPSRIFAERSNSYGVNIDI
ESEAKPFEEQVNAFLSKQWEASPIINGEIQFESMIKAAGQPELVKAPYDRRIEVGQVFHA
SHDHVSAAIETAHAAFAEWNQAPAQARAEKLDKLADLLEANLAELVAICHQEAGKTIHDS
IDEVREAVDFCRYYAKRVDTLGEFSVEGFDGQSRQVARQGRGVFVCISPWNFPLAIFLGQ
ISAALVAGNTVVAKPAEQTSLIAARAVELMLEAGFPGGVIQLLPGRGSQIGTALTSHAAI
AGVAFTGSTATAQRINQTLAERDADPVPFIAETGGQNAMIVDSTALPEQVVRDVLRSAFA
SAGQRCSALRVLFVQQDVADRIITLIQGAMQELSVGTPYLHNTDVGPVIDAKAKQGLLEH
IERMTKTQKKVAQLELGEVCEHGDFVAPTAFEISGIDCLTEEQFGPILHIVRFKASELAQ
VVQQINDTGFGLTMGIHSRNETTYRWIEKHARVGNCYINRDQVGAVVGVQPFGGQGLSGT
GPKAGGPHYLYRFTQVQYS
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atgtttacagcaacagatgtgttgaaagcagagtttgttgagcagccgcttagcaagctg
tggtcaaagatctcgccactttacatggtggacgaatcccaatggctagagcagctttta
cctttggcgaccccaagcgatgcagaaaaatcgtcgatggccgtcaaaaccactgaactt
atcgaagcaattcgtaaggacaaaaagtcgattcagatgatcgacgccctgcttcttgag
tacagtttggatactcaggaaggcattcttctgatgtgtctggctgaagcgctgatgcgt
attccggatactgaaaccgctgacgcgttcattcgtgaccgcttgggcgtggcagactgg
aaatctcacctgaagagctcagattcggtgttcgttaacgcgtccacctggggtttgatg
ctgaccggtaaagtgattggtctggccgatgcagaaggcaccagcccgattcaagcggta
aaccgcttggtgaacaagctgagtgagccggtgattcgtaaagcgatgcatcaggcgatg
aagatcatgggtcaccagttcgttctgggtcgcaccattgccgaagcgcagaaaaacggt
cgtccgatgcgcgataaaggctacacctactcatttgatatgttgggtgaagcggcgctg
accacggcagacgcgaacaaatatttcaaagattacctgatggcgattgaagcggttggc
cgcgacaaatacggtttggacaccagcccggcaccatcagtatcgatcaaactttccgcg
ctgcacccgcgttatgaagtggcaaaccgcgaccgcgtaatgactgagctgtacagcacg
ctgatccaactgctggatcgtgcgatggagctggatgtggcgatcacgatcgacgcagaa
gaagcggatcgtctggaactgtcactggaactgtttgaaaaagtttaccgcagcgagaaa
gtgaaaggctggggcaaatttggtctggtggtgcaggcgtactcaaaacgtgccctgcca
gtcctggtttggctgactgcactggcgaaagagcagggcgatttgattccggtgcgtctg
gtaaaaggcgcttactgggacagcgaaatcaaatggtcacagcagagcggttacaccggt
tatccggtttacacccgcaaagaagcgaccgatgtttcttacctggcgtgtgcccgcttc
ctgctgagcgaaagcgtgcgcggcaatctgttcccacaatttgccagccacaatgcgcag
accgtaaccgcaatcgcggtgatggcgcagcacaaagactttgaattccagcgcctgcac
ggtatgggcgatgcgctctacaaccacgtcatggcggcatacaagcaatctgtgcgtatt
tacgcacccgtgggtagccacaaagatctgctgccgtatctggttcgtcgtctgctggaa
aacggcgcgaacagctcattcgtacaccgtctggtggatgcgcgctgcccaatcagcacg
ttgactcaacatccggtggacatgttgctggcgttcgatacgttgaataacaccaagatt
cctctgccttcacgcatttttgctgagcgcagcaactcctacggtgtcaacatcgacatc
gagagtgaagcgaagccattcgaagagcaggtcaatgcgttcctgagcaaacaatgggaa
gcatcgccgatcattaacggcgagattcagttcgaaagcatgatcaaggcagctggccag
ccagaactggttaaagcgccgtatgatcgtcgcatcgaagtgggccaggttttccatgct
agccatgatcatgtttccgcagcgatcgaaaccgcacatgctgcatttgctgagtggaac
caagctccggcacaagcgcgtgctgagaaactggacaaactggcggacctgctggaagcc
aatctggctgaactggtggcaatttgtcatcaggaagcgggtaaaaccattcacgacagc
attgatgaagtgcgcgaagcggtcgacttctgtcgttactacgccaaacgcgtagacaca
ctgggcgagttctcggtagagggctttgatggtcagagccgtcaggttgctcgtcagggc
cgcggtgtattcgtatgtatcagtccgtggaacttcccgctggcgattttcctaggccaa
atcagtgccgcactggttgcgggtaacaccgtcgtggccaaacctgcagaacaaaccagc
ctgatcgcagcgcgcgctgtcgaactgatgctggaagcgggtttccctggcggcgtgatt
cagttactgcctggtcgcggttcgcaaatcggtacggcgttgacgtcacacgcggccatt
gctggtgtggcgtttacgggttccactgcgacagcccagcgcatcaaccaaacgttggct
gagcgcgatgctgatcctgtgccgtttatcgcggagactggtggtcagaacgcgatgatc
gtggacagtacagccctgcctgagcaagtggtgcgtgacgttctgcgctctgcctttgcg
tcggcgggtcagcgttgttcagcactgcgtgtgctgtttgttcagcaagacgttgccgat
cgcatcattaccctgattcagggcgcgatgcaggagctttctgtcggtactccttatctg
cacaacacggatgtgggtccggtgatcgatgcgaaagctaagcaaggtctgcttgagcac
atcgaacgcatgaccaaaacgcagaagaaagtggcacagctggaactgggcgaggtgtgt
gaacacggtgatttcgttgcgccgactgcgtttgaaatctcgggtatcgactgcctgacc
gaagagcagtttggcccaatcctgcacatcgttcgcttcaaagcgagtgaattggcgcag
gtggttcagcaaatcaacgataccggttttggtctgaccatggggatccacagccgtaac
gaaacgacctatcgctggattgaaaaacacgcgcgtgtgggtaactgctacatcaaccgt
gaccaagttggtgcggtcgtcggtgtgcagccgtttggtggtcagggcctgtccggcacc
ggaccaaaagcaggtggtccacactacctgtaccgtttcactcaagttcagtacagctaa

DBGET integrated database retrieval system