KEGG   Vibrio fluvialis: AL536_02765Help
Entry
AL536_02765       CDS       T04379                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
vfl  Vibrio fluvialis
Pathway
vfl00860  Porphyrin and chlorophyll metabolism
vfl01100  Metabolic pathways
Module
vfl_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:vfl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AL536_02765
Enzymes [BR:vfl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     AL536_02765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB
Motif
Other DBs
NCBI-ProteinID: AMF92419
UniProt: A0A0X8LI78
Position
1:570839..572323
Genome map
AA seq 494 aa AA seqDB search
MKSSLNALMVQGTTSDAGKSVLVAGLCRVLARKGIRVAPFKPQNMALNSAVTPDGGEIGR
AQAVQALACGIEPSVHMNPVLLKPNSDTGAQVILQGRALSNMEANGYHDYKKVAMHTVLD
SFSRLQSEYESIMIEGAGSPAEINLRENDIANMGFAEEADVPVIIVADIDRGGVFAHLFG
TLALLSESEQNRVKGFVINRFRGDIRLLQSGLDWLEEKTGKPVIGVLPYLHGFDLEAEDA
ITANQVVGQQVKLNVVVPVFTRISNHTDFDALRLNPDINLRYVGKGERLDRADLIILPGS
KSTRADLEYLKRQGWDKDIQRHLRLGGKVMGICGGYQMLGEWVHDPEGVEGQPGSSEGLG
LLAMETTLTGEKQLTNVKGTLHLNGKSTPVSGYEIHVGRSVSSPASNCTRVIELTHGEQD
GLVSDCNQILGTYLHGIFDTFSAAELICQWAGADAIQVHDHVAAKEQAIDRIADAIEQHL
NLALLWPELNGLLS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgtcattaaacgctctgatggtgcagggcaccacgtccgatgccggaaaaagt
gttctggtggcaggtctctgccgggtgttggcccgaaaagggattcgtgttgcccccttc
aagccgcaaaatatggcgctcaacagcgcggtgacgccggacggtggtgaaattggccgc
gcacaggcagttcaggcccttgcttgtggaattgagccgagcgtgcacatgaatccggtg
ttgctgaaaccgaactcggataccggagcgcaggtgatcctacaggggcgcgcactgagc
aacatggaggccaacggctaccatgattacaaaaaagtggcgatgcatacggtgttagat
tccttctctcgtctgcaaagtgaatacgaaagcatcatgattgaaggggcaggcagcccg
gcagaaatcaatctgcgcgaaaatgacattgccaatatggggtttgccgaagaagcggat
gtgcccgttattattgtggccgacattgaccgtggtggcgtgtttgcgcatctgtttggc
acgttggcactattgtctgaatctgagcaaaaccgggtcaaaggttttgtgatcaaccgc
tttcgtggcgacattcgtttgttgcaatccggtctcgactggctggaagaaaaaacgggc
aagccggtgattggtgtcctgccgtatctgcacggctttgatctggaagcggaagacgca
atcacggccaatcaggttgtcggccagcaggtcaaactcaatgttgtggtgccagtgttt
acccgcatcagcaaccataccgattttgatgcgttgcgactcaatccagatattaacctg
cgttatgtgggtaagggtgaacgtttagaccgtgccgacctcatcattctgcctggcagc
aaatcgactcgcgctgatctggagtatctgaagcggcaaggctgggacaaagatattcag
cgtcatttgcgtttaggtggcaaagtgatgggaatttgtggtggctatcagatgttgggc
gaatgggtacatgatcccgaaggtgtcgaaggtcagcccggcagcagcgaaggtctgggt
ttgctcgccatggaaacgacactgacgggcgagaagcagctcaccaacgtcaaaggaact
ttacatcttaacggtaagtctacacccgtctccggctacgaaattcacgtcggccgcagt
gtgtcttcgccagcgtcaaactgcacacgggtgattgaacttacccatggtgagcaagat
ggcctagtcagtgactgcaatcaaatacttggcacctatttacacggtatatttgatacc
ttttctgctgccgaattgatttgtcagtgggccggcgcagacgcaattcaagtgcatgat
catgttgcagcaaaagagcaggcgatcgatcgtattgctgatgctatcgagcagcatctg
aatcttgctttattatggccagaactcaatggactcttatcatga

DBGET integrated database retrieval system