KEGG   Vibrio fluvialis: AL536_05220Help
Entry
AL536_05220       CDS       T04379                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vfl  Vibrio fluvialis
Pathway
vfl00071  Fatty acid degradation
vfl00072  Synthesis and degradation of ketone bodies
vfl00280  Valine, leucine and isoleucine degradation
vfl00310  Lysine degradation
vfl00362  Benzoate degradation
vfl00380  Tryptophan metabolism
vfl00620  Pyruvate metabolism
vfl00630  Glyoxylate and dicarboxylate metabolism
vfl00640  Propanoate metabolism
vfl00650  Butanoate metabolism
vfl00900  Terpenoid backbone biosynthesis
vfl01100  Metabolic pathways
vfl01110  Biosynthesis of secondary metabolites
vfl01120  Microbial metabolism in diverse environments
vfl01130  Biosynthesis of antibiotics
vfl01200  Carbon metabolism
vfl01212  Fatty acid metabolism
vfl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL536_05220
   00630 Glyoxylate and dicarboxylate metabolism
    AL536_05220
   00640 Propanoate metabolism
    AL536_05220
   00650 Butanoate metabolism
    AL536_05220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AL536_05220
   00072 Synthesis and degradation of ketone bodies
    AL536_05220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL536_05220
   00310 Lysine degradation
    AL536_05220
   00380 Tryptophan metabolism
    AL536_05220
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AL536_05220
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AL536_05220
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL536_05220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vfl04147]
    AL536_05220
Enzymes [BR:vfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AL536_05220
Exosome [BR:vfl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL536_05220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF2285
Motif
Other DBs
NCBI-ProteinID: AMF92871
UniProt: A0A0X8LJ07
Position
1:complement(1114554..1115774)
Genome map
AA seq 406 aa AA seqDB search
MEKAIWIVSAKRTPQGRFQGALKEYTAPQLGGAAIKAALNDTSAPIEQVDEVLMGCVLPA
GCGQAPARQAALNAGLPLSVGATTLNKVCGSGMKAVMLAHDLIKAGSAQCIIAGGMESMT
NAPYLLSNARSGMRMGHQTTFDHMFLDGLQDAYDGHLMGVFAQQIADKLEFSREAMDEWA
ALSAQRAWEAQEQQLFVAEMTPLTFGKQAELLDYDEHPRSIKLDKIPQLKPAFAEDGSVT
AANSSAIADGAAALMLMDEESARSQGLDPLAVIRGHATHARLPAEFTLAPVYAIEQLLSQ
LDWTVDEIDLWEINEAFAVVTQIAVQQLGLDVDKVNVKGGACALGHPIGASGARILVTLI
HSLRQLQALGVNGDKSEQKVMRGVASLCIGGGEATAIAIEIPLSEA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagccatctggattgtatctgccaaacgaacgccgcaagggcgttttcaggga
gcattgaaagaatacaccgcgccgcaattgggcggagcggccattaaagcggcattgaac
gacacatcggcccccattgaacaagtcgatgaagtgctcatgggctgcgttctgcctgcc
ggctgcggccaagcgccagcaaggcaagcggcactgaatgcgggtctaccgctctcggtg
ggggcaaccaccttaaacaaagtgtgtggctctggcatgaaagccgtgatgctggcgcat
gacctcatcaaagcgggcagtgcgcaatgcattattgcgggcgggatggagagcatgacc
aatgcgccgtacctgctgagcaacgctcgcagtggcatgcggatgggccaccaaactacc
tttgatcacatgtttctcgatggattgcaggatgcttacgacgggcacctgatgggcgtg
tttgcccagcagatcgccgacaaacttgagttcagtcgcgaagcgatggacgaatgggca
gcgctgtctgcgcaacgtgcctgggaagcgcaggagcagcaactctttgtcgctgaaatg
acgccgctgacgtttggtaaacaggccgaactgctcgattacgacgaacatccgcgttcc
atcaagctcgacaaaatcccgcagcttaaacccgcctttgccgaagatggcagtgtcacg
gcggccaactccagtgccatcgccgatggtgctgctgccttgatgttgatggatgaagaa
tccgcgcgttcgcaaggtttggatcctttagcggtgattcgcggccacgccactcacgcc
agattgccagcagaatttaccctggcgccggtgtacgccatcgaacaactgctgtcgcag
cttgactggacggtggatgaaatcgatctgtgggagattaacgaagcgttcgctgtggtc
acccaaatcgccgtgcagcagcttgggctggatgtcgacaaagtgaatgtcaaaggcggt
gcttgcgcgctgggtcacccgatcggagccagtggcgcgcgcattctggtcacgttgatc
cacagcctgcgtcagttgcaggcgctgggcgtcaacggcgataagtcagagcagaaagtg
atgcgcggcgttgcatcgctctgtatcggcggcggtgaagccacggccatcgcgattgaa
attccgctgtcggaagcctga

DBGET integrated database retrieval system