KEGG   Vibrio fluvialis: AL536_13140Help
Entry
AL536_13140       CDS       T04379                                 

Gene name
maiA
Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
vfl  Vibrio fluvialis
Pathway
vfl00350  Tyrosine metabolism
vfl00643  Styrene degradation
vfl01100  Metabolic pathways
vfl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vfl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AL536_13140 (maiA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    AL536_13140 (maiA)
Enzymes [BR:vfl01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     AL536_13140 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AMF94419
UniProt: A0A0X8LM03
Position
2:1186647..1187294
Genome map
AA seq 215 aa AA seqDB search
MGERKLYGYWRSSAAYRVRIALNLKGLEYTHCPVHLVKEGGEQHSAAYHQLNPSELVPTL
VDDGVTLSQSLAIIEYLDDVYPQMPLIPRSGHKKYQVLSLAHDIAMDIHPINNLRVLQYL
SNELAVNDEQKAEWYRHWVQVGFAAFEEKLNTRAGAFCVGDELSLADVCLVPQVYNAERF
SVDMTPYPQIQRITQSLRAIPGFIKAEPENQPDAQ
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaacgtaaactctacggctactggcgatcatcagcggcgtatcgggttcgtatt
gcactcaatctcaaaggactcgaatatacacactgtccggtgcatctggttaaagagggc
ggcgagcagcacagcgccgcctaccatcagttaaaccccagtgagttagtgccgaccttg
gttgatgatggtgtgacattgtcacaatctctggccatcatcgaatacttggatgatgtg
tatccacaaatgccgttgatcccgagaagtggccacaagaaatatcaggtgttgtcgctg
gcgcatgatattgcgatggacatccatcccatcaacaacctgcgtgtcttgcagtatctg
agcaacgaacttgctgtgaatgatgagcaaaaagccgaatggtatcgtcactgggttcag
gtcgggtttgctgcctttgaagagaaactcaacacgcgcgccggggcgttttgtgtcggc
gatgaactgtcgttggcggatgtgtgtttggtgccgcaggtatacaacgccgaacgtttc
agcgtggatatgacgccgtatccacaaattcaacgcatcacccaatccttacgtgcgata
cccggattcatcaaagcggaaccggagaatcagcctgacgcgcaatga

DBGET integrated database retrieval system