KEGG   Vibrio fluvialis: AL536_15945Help
Entry
AL536_15945       CDS       T04379                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
vfl  Vibrio fluvialis
Pathway
vfl00450  Selenocompound metabolism
vfl00970  Aminoacyl-tRNA biosynthesis
vfl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AL536_15945 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AL536_15945 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vfl01007]
    AL536_15945 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vfl03016]
    AL536_15945 (metG)
Enzymes [BR:vfl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AL536_15945 (metG)
Amino acid related enzymes [BR:vfl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AL536_15945 (metG)
Transfer RNA biogenesis [BR:vfl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AL536_15945 (metG)
 Prokaryotic type
   Other AARSs
    AL536_15945 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 FeoC PhnA_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: AMF94935
UniProt: A0A120L417
Position
2:1795373..1797424
Genome map
AA seq 683 aa AA seqDB search
MATEPRKLLVTCALPYANGSIHLGHMLEHIQADIWVRYQRLRGNTVNFICADDAHGTPIM
LKAQQMGMTPEEMIAAVSEEHQKDFAGFDISFDNYHSTHSEENRELASHIYLELKKNGFI
SSRTISQLFDPEKEMFLPDRFVKGTCPKCKSEDQYGDNCDACGETYSPTELINPKSAVSG
ATPIMKDSEHFFFDLPQFESMLKEWTRSGSLQSETANKMQEWFESGLQQWDISRDAPYFG
FEIPGEKNKFFYVWLDAPVGYMASFKNLCNKTDGLDFDEYWKKDSTTELYHFIGKDIVYF
HSLFWPAMLEGSGFRKPNNVFVHGYVTVNGAKMSKSKGTFVKASTYLSHLDPECLRYYYA
AKLNSRIDDLDLNLEDFTQRVNADVVNKIVNLASRNAGFITKRFDGKLSDSFAEPQLYNE
FAAAADRIAELYEAREFGRAIREITALADKANQYVDEKAPWVVAKQEGQDQALQDICTVG
INLFRVLLTYLKPVMPALAARSEAFLNQELTWDGVAQPLTGHTVSAFKALFNRIDPKHIE
AMIEASKEEAAAEKAAAEAAAPKAQQTELSKDPIAAEIEFDDFAKVDLRIAKIVSCESVP
KADKLLKFQLDIGGEMRQVFSGIKAAYNPEDLVGKYTVVVANLKPRKMKFGMSEGMILAA
GPGGSELWILEPHEGAQPGMRVM
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgaaccaagaaaacttttggtaacttgtgcccttccgtacgctaacggttcg
atccacttaggtcatatgcttgagcatatccaagcggatatttgggttcgttaccagcgc
ctacgcggcaacactgtaaacttcatctgtgctgacgatgctcacggcacgccaatcatg
cttaaagcgcaacagatgggtatgactccggaagagatgattgctgcggtcagtgaagag
caccaaaaagacttcgcaggctttgatatcagctttgacaactaccacagcacacacagt
gaagagaaccgtgaactggcttctcacatctatctggagctgaaaaagaacggttttatt
tccagccgcaccatttctcagctgtttgaccctgagaaagagatgttcctgccggatcgt
ttcgtgaaaggcacctgcccgaaatgtaaatctgaagaccagtacggcgacaactgtgat
gcttgtggcgaaacttacagcccgacagaactgatcaacccgaaatcagcggtttctggc
gcgacgccaatcatgaaagattctgagcacttcttcttcgatctgcctcagtttgaaagc
atgctgaaagagtggacgcgttcaggctcgctgcaatctgaaactgccaacaagatgcaa
gagtggtttgaatctggcctgcaacagtgggacatttcccgcgatgcgccttacttcggt
tttgaaattccgggcgaaaagaacaagttcttctacgtgtggctggatgcacctgtgggt
tacatggcgtcgttcaaaaacctgtgtaacaagacggacggtctggacttcgatgaatac
tggaagaaagacagcaccacagagctgtaccacttcatcggtaaagacatcgtttacttc
cacagcctgttctggccagcgatgctggaaggcagcggtttccgcaaaccaaacaacgtg
ttcgtacatggctacgtgacggtaaacggcgcgaagatgtctaagtctaaagggacgttc
gtaaaagcgagcacttacctcagccacttagatcctgagtgtctgcgttactactacgcc
gcgaaactgaacagccgtatcgacgatctcgatctgaatctggaagacttcacacagcgc
gtgaacgctgacgtggtgaacaagattgtcaatctggcttcacgtaatgcaggtttcatc
actaagcgttttgacggcaaactgtctgacagctttgcagaacctcagctgtacaacgaa
tttgctgcggctgccgatcgtatcgctgagctttacgaagcgcgcgaatttggccgcgcc
attcgtgaaatcaccgcactggcggataaagccaaccagtacgttgacgaaaaagcacct
tgggttgtggccaaacaagaaggtcaggatcaagcactgcaggatatctgtactgtcggt
atcaacttattccgcgttctgctgacttacctgaaaccggtgatgccagcactggcggct
cgctcagaagccttcctgaaccaggaactgacttgggacggcgtagctcaacctctgact
ggccacaccgtcagcgcgttcaaagcgctgttcaaccgtatcgatcctaaacacatcgaa
gcgatgattgaagcatcgaaagaagaagctgctgctgagaaagccgctgcggaagctgcc
gcacctaaagcgcagcaaactgagctgagcaaagaccctatcgcagccgaaatcgaattt
gatgacttcgcgaaggttgacctgcgtattgctaagattgtctcttgtgagtcagtgcct
aaagctgacaaactgctgaagttccaacttgatatcggtggtgaaatgcgtcaggtattc
tcgggtatcaaagcggcttacaacccggaagatctggttggcaaatacaccgttgtggtg
gcaaacctgaaaccacgtaagatgaagttcggcatgtcagaaggcatgatcctggccgcc
ggccctggtggcagcgagctgtggattctggaacctcatgaaggtgcccaaccaggtatg
cgtgtgatgtaa

DBGET integrated database retrieval system