KEGG   Vibrio fluvialis: AL536_16640Help
Entry
AL536_16640       CDS       T04379                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
vfl  Vibrio fluvialis
Brite
KEGG Orthology (KO) [BR:vfl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vfl03016]
    AL536_16640
Enzymes [BR:vfl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     AL536_16640
Transfer RNA biogenesis [BR:vfl03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    AL536_16640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AMF95063
UniProt: A0A0X8LN81
Position
2:complement(1942464..1943195)
Genome map
AA seq 243 aa AA seqDB search
MLEIIYQDEYIVAVNKPAGMLVHRSWLDKHETHFVMQTLRDQIGQHVFPLHRLDRPTSGV
LVFALSSEIAANMMPMFANHEMEKTYHAIVRGWIEEGDVLDYPLKEELDKIADKFAKQDK
EPQSAVTAYQPLAKVEVPHSTGKFPTTRYCLMEMKPKTGRKHQLRRHMAHLRHPIVGDTT
HGDGKHNRLYREVYDAQRLMLHASELRFIHPYTEQELVLRAGFDPIWQRLFAQFAWNEPQ
PAV
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaatcatttatcaggacgagtacatcgtggctgtcaacaagccagcgggcatg
ttggtgcatcgcagttggctcgataagcatgaaacccatttcgtgatgcagacgctgcgc
gatcagattggtcagcatgtgtttccgttgcaccgtctcgatcgcccgacctccggggta
ttggtgtttgcactgtccagtgagattgccgccaacatgatgccgatgtttgccaatcat
gagatggaaaaaacctatcatgcgatcgtgcgcggctggattgaagagggggatgtactt
gattatccgcttaaagaagagctggataaaatcgccgacaagtttgccaagcaggataaa
gagccacagtcagcagtgacggcgtatcagccattggccaaagtcgaagtgccgcattcg
acgggcaagtttcccactacgcgttactgcctgatggaaatgaaacccaaaaccggacgt
aaacatcaattgcgtcgccacatggcgcatctgcgtcatccgattgtcggtgatactact
cacggcgatggcaaacacaaccgtctgtatcgtgaggtgtatgacgcgcagcgtctgatg
ttgcatgccagcgagctgcgttttatccatccttacacggaacaggagctggtgctgcga
gccgggtttgacccaatctggcagcgcctgtttgcgcagtttgcgtggaatgagcctcag
cctgcggtctga

DBGET integrated database retrieval system