KEGG   Aliivibrio fischeri MJ11: VFMJ11_0052Help
Entry
VFMJ11_0052       CDS       T00754                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
vfm  Aliivibrio fischeri MJ11
Pathway
vfm00860  Porphyrin and chlorophyll metabolism
vfm01100  Metabolic pathways
vfm01110  Biosynthesis of secondary metabolites
vfm01120  Microbial metabolism in diverse environments
Module
vfm_M00121  Heme biosynthesis, glutamate => heme
vfm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VFMJ11_0052 (hemB)
Enzymes [BR:vfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     VFMJ11_0052 (hemB)
Exosome [BR:vfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VFMJ11_0052 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACH64989
UniProt: B5FF85
Position
I:56756..57772
Genome map
AA seq 338 aa AA seqDB search
MSVSILGAFPNRRMRRMRKHEFSRRLMAENQLTVNDLIYPMFVLMGKDRRESVESMPGVE
RLSIDLLLEEAQRLYDLGIPAIAIFPVVSQDVKSLCAAEAYNPEGLVQRTVKALKEHVPE
LGVITDVALDPFTTHGQDGIIDEDGYVMNDVTTEVLIKQALSHAEAGADVVAPSDMMDGR
IGEIRKALEKAGHVHTQIMAYSAKYASCYYGPFRDAVGSSSNLKGGNKKNYQMDPANSDE
AIHEVAMDINEGADMVMVKPGMPYLDIVRRVKTELQVPTFAYQVSGEYAMHKAAIMNGWL
SERDTVMESLLCFKRAGADGILTYFAKDVAEWLAEDKK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtatccattcttggtgcgtttccaaaccgccgcatgcgccgtatgcgtaaacat
gaatttagccgccgactaatggctgaaaaccaactaacagtaaatgatttgatttatcca
atgtttgttcttatgggtaaagatcgtcgtgagtctgttgagtctatgccgggtgttgag
cgtttatctatcgatttactgcttgaagaagcgcaacgtctttatgatttaggtattcct
gcgattgcaatttttcctgtggtttctcaagacgttaaaagtctatgtgctgctgaagct
tataaccctgaaggtctagttcaacgtacagttaaagctctaaaagaacatgtgccagag
cttggtgtgattacggatgtggctttagacccattcacaactcacggtcaagacggcatc
atcgatgaagatggttacgtaatgaatgacgtaacaacagaagttctgattaagcaggca
ttatcgcacgctgaagcaggtgctgatgtggtggctccgtctgacatgatggatggtcgt
attggtgagatccgtaaagcgttagaaaaagcgggtcatgttcatacacaaattatggcg
tattctgcaaaatacgcatcttgttactacggacctttccgtgatgcagtcggctcttca
tcgaacttgaaaggcggtaataagaaaaattaccagatggatcctgcaaacagtgatgaa
gcaattcatgaagttgctatggacatcaatgaaggtgctgatatggtgatggtgaaacca
ggtatgccgtatctggacatcgttcgtcgtgttaaaactgaacttcaagttcctacgttt
gcttatcaagtgtctggtgagtatgcgatgcacaaggccgcaattatgaatggttggttg
agtgagcgcgatacggtaatggaatcgttactgtgctttaagcgtgctggtgctgacggc
atcctaacttactttgcgaaagatgtagcagagtggttggcggaagataagaagtaa

DBGET integrated database retrieval system