KEGG   Aliivibrio fischeri MJ11: VFMJ11_0160Help
Entry
VFMJ11_0160       CDS       T00754                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
vfm  Aliivibrio fischeri MJ11
Pathway
vfm00521  Streptomycin biosynthesis
vfm00523  Polyketide sugar unit biosynthesis
vfm01130  Biosynthesis of antibiotics
Module
vfm_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    VFMJ11_0160 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    VFMJ11_0160 (rfbC)
Enzymes [BR:vfm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     VFMJ11_0160 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Peptidase_M1
Motif
Other DBs
NCBI-ProteinID: ACH64852
UniProt: B5FFU4
Position
I:177893..178462
Genome map
AA seq 189 aa AA seqDB search
MKVTDTRIPDVKIIEPSVFGDERGFFMETWNQKQFEELVTGKLTQFVQDNHSKSKKGILR
GLHYQTENTQGKLVRVISGEVFDVAVDIRKGSPTFGQWIGEYLSAENKRQLWIPEGFAHG
FYVTSEEAEFVYKCTDYYNPTAEVSIKWDDPTVNIEWPLKMLPSLSNKDKKAKMFNDVIK
EIYGDNNAN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaccgatacccgaatccctgatgtaaaaattatagaaccaagtgtgtttggt
gatgagcgaggtttctttatggaaacctggaatcaaaagcagtttgaagagttggtaaca
ggtaagctcacccaatttgtacaagataatcattccaaatctaagaaaggaattttacga
ggattgcattaccaaacagaaaacactcaggggaaattagttcgagtgatttctggtgaa
gtgtttgatgttgcagttgatattcgaaaaggctcaccgacgtttggtcaatggataggt
gaatatttatcggctgaaaacaagcgtcaactttggataccggaaggttttgcgcatggt
ttttatgtgacgagtgaagaagcagagttcgtatataagtgtacggattattacaatccg
acagctgaagtatcaattaagtgggatgaccctacagtaaatatagagtggccgttaaaa
atgcttccttctctgtcaaacaaagataagaaagcaaaaatgtttaatgacgttataaaa
gaaatttatggagataacaatgctaattga

DBGET integrated database retrieval system