KEGG   Aliivibrio fischeri MJ11: VFMJ11_0230Help
Entry
VFMJ11_0230       CDS       T00754                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
vfm  Aliivibrio fischeri MJ11
Pathway
vfm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:vfm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    VFMJ11_0230 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vfm03011]
    VFMJ11_0230 (rplV)
Ribosome [BR:vfm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    VFMJ11_0230 (rplV)
  Bacteria
    VFMJ11_0230 (rplV)
  Archaea
    VFMJ11_0230 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACH65041
UniProt: B5FG14
Position
I:245841..246173
Genome map
AA seq 110 aa AA seqDB search
MEAIAKHRFAGISPQKARLVADQVRGKSVDQALEILTFSNKKAAVLVKKVLESAIANAEH
NEGADIDDLNVAKIFVDEGPIMKRIMPRAKGRADRILKRSSHITIVVADR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagctattgctaaacatcgttttgccggtatttcaccacagaaagctcgcctagtt
gcggaccaagtacgtggtaaatctgtagaccaagctctagaaatcctaactttcagcaac
aaaaaagctgctgtattagtgaagaaagttcttgagtctgcaatcgcaaacgctgaacac
aacgaaggtgcagatatcgacgatctaaatgtcgctaaaatcttcgtagatgaaggccct
atcatgaagcgtattatgcctcgtgctaaaggtcgtgcagatcgcatcttgaagcgttca
agccacatcactatcgttgtagctgatcgttaa

DBGET integrated database retrieval system