KEGG   Aliivibrio fischeri MJ11: VFMJ11_1085
Entry
VFMJ11_1085       CDS       T00754                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
vfm  Aliivibrio fischeri MJ11
Brite
KEGG Orthology (KO) [BR:vfm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vfm02044]
    VFMJ11_1085
Secretion system [BR:vfm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VFMJ11_1085
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ACH67306
UniProt: B5FD88
Position
I:complement(1141706..1142131)
AA seq 141 aa
MSNQRLFERLLSGTTQSNQSVTAQHMTESIRSHVSQLLSTRQGAALICPDLGLPDLNMSH
MSPHDAILHIKREVERVIARYETRIINPQVRYLGDIYNPLRLYFDVRGDVIINGQNTAIS
FTAHAQAANRKAETNITQGAA
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtcgaaccaacgattatttgaacgactattaagtggtacaacacaaagcaatcaatct
gtcacagctcagcatatgacagaatcaattcgctcacacgtcagtcagttactttcaaca
agacaaggagctgcattgatctgtcctgatttaggcttgccagatcttaatatgtctcac
atgagtccgcatgatgccatccttcatatcaaacgcgaggttgaacgagttatcgctcgc
tatgaaacgagaatcattaatcctcaagttcgttatttgggggatatctataatccttta
cgtctctattttgatgtgagaggtgatgtcatcatcaatgggcaaaataccgctatttca
tttaccgctcatgctcaggctgctaaccgcaaagctgaaaccaatattacacaaggtgca
gcatga

DBGET integrated database retrieval system