KEGG   Aliivibrio fischeri MJ11: VFMJ11_1087
Entry
VFMJ11_1087       CDS       T00754                                 

Definition
(GenBank) type VI secretion protein, family
  KO
K11901  type VI secretion system protein ImpB
Organism
vfm  Aliivibrio fischeri MJ11
Brite
KEGG Orthology (KO) [BR:vfm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vfm02044]
    VFMJ11_1087
Secretion system [BR:vfm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VFMJ11_1087
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACH65810
UniProt: B5FD90
Position
I:complement(1143700..1144200)
AA seq 166 aa
MSKDGSVAPKERVNVTFKPVSGDAAEDLELPLKMMVLGDFTQQEDDRKLEDRKPFNVDKS
NFNDVIEKQNLNISFGVKNQLQDDGEGNEEIAVDLSFKHINDFDPSSIVEQVPELKGLMD
LREALVSLKGPLGNVPAFRKAIEDALVDDEAREKLLSELGLVTEKE
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtcaaaagatggatctgttgcaccaaaagaacgtgtaaatgtgacattcaaaccagta
agcggtgacgctgcagaagatcttgaacttccactgaaaatgatggttcttggtgacttt
actcagcaagaagatgatagaaaacttgaagatcgaaaaccatttaatgttgataaaagc
aatttcaatgacgttattgaaaaacaaaacctaaacatttcttttggtgtgaaaaaccaa
cttcaagatgatggcgaaggaaatgaggaaatagcagttgatctaagttttaaacatatc
aatgattttgatccttcaagcattgttgagcaagtacctgaactaaaaggcttaatggat
ttacgtgaagcgcttgtctctttaaaaggcccgttaggcaatgttcctgcattccgcaaa
gcaattgaagatgcccttgttgatgatgaagctcgtgaaaaactactaagtgaattaggt
ctagtgacagaaaaggaataa

DBGET integrated database retrieval system