KEGG   Aliivibrio fischeri MJ11: VFMJ11_1112Help
Entry
VFMJ11_1112       CDS       T00754                                 

Definition
(GenBank) tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
vfm  Aliivibrio fischeri MJ11
Pathway
vfm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vfm01100  Metabolic pathways
vfm01110  Biosynthesis of secondary metabolites
vfm01130  Biosynthesis of antibiotics
vfm01230  Biosynthesis of amino acids
Module
vfm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VFMJ11_1112
Enzymes [BR:vfm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VFMJ11_1112
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     VFMJ11_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C Eco57I
Motif
Other DBs
NCBI-ProteinID: ACH65988
UniProt: B5FDB8
Position
I:complement(1168138..1169550)
Genome map
AA seq 470 aa AA seqDB search
MTQQLSEHISVENTEMAEVLVKIVKDKAIWVEERKKQQPLDAFQSSLSLSDRSFYDALKT
GKTEFILECKKASPSKGLIRDDFDLDYIASVYNNHASAISVLTDEKYFQGSFDFLPIIRN
QVSQPILCKDFMIDAYQVYLARHYSADAILLMLSVLDDAQYKALADIAHSLNMGILTEVS
NEEELHRAVALNAKVIGINNRNLRDLSTDLNRTKELAPLLPKGTTIISESGIYTHQQVKD
LAQHASGFLIGSSLMAEKNLELAARKVILGENKVCGLTSEQDAKAVYDSGAVYGGLIFVE
KSPRFVSLETAKKITQATALHYVGVFQNEDAQRVAQYATDLSLSVIQLHGNETEAYITEL
ASLLPTHTQIWNVISVSDDAQSISLPQTQADKVLVDCNVGSQVGGTGVSFDWNKLPHHNI
MLAGGLELNNTKEAAQLGCYGLDFNSGVESTPGKKDHKKLSAVFSALRDY
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcaattgtctgaacacatctcagtagaaaatacagaaatggctgaagtactt
gtaaaaatagtaaaagacaaagccatttgggtcgaagagcgtaagaaacaacaacctcta
gatgcttttcaatcgtcattaagtctatctgaccgtagcttttacgacgcattaaaaaca
ggcaaaaccgaatttatccttgaatgtaaaaaagcatcaccatcaaaaggattaattcga
gatgatttcgatctcgattacattgcttctgtctacaataatcacgcgagtgccatttct
gtactaaccgatgaaaagtatttccaaggtagctttgatttcttacctatcattcgaaat
caagtatcacagcctattttatgtaaagatttcatgatagatgcttatcaagtgtatctt
gctcgtcattactctgctgatgccattttattaatgctttctgttttagatgatgcgcag
tacaaagcacttgcagacatagcacattcattaaacatgggtattttaacggaagtcagc
aatgaagaagaattgcatcgtgctgtggcattaaacgcaaaagtcattggaattaacaac
cgtaacctacgtgacttatcaacggatttaaatagaacaaaagaactagctcctctactg
cctaaaggtacaaccattatttctgagtcaggtatttatactcatcaacaagtaaaagat
ctggctcagcacgcttcaggctttctgattggtagctcactaatggcagaaaaaaaccta
gagcttgcagcaagaaaagttattttaggtgaaaacaaagtctgtggattaacttcagag
caagatgcgaaagccgtttatgactctggagctgtctacggcggacttattttcgtagaa
aaatcaccacgttttgtttctcttgaaaccgcaaagaaaataacccaagcaacagcatta
cattatgtgggcgttttccaaaatgaggatgctcagcgtgttgctcagtacgccactgac
ctttctctatctgtgattcaactgcatggaaatgaaaccgaagcgtatattactgagtta
gcctctttattaccgactcatactcaaatttggaatgtcatttctgtgtcagatgatgct
caaagcatttcacttccacaaactcaagctgataaggtgttagttgactgtaatgtaggt
tctcaggtgggaggtactggcgtaagttttgattggaataaactgcctcaccacaacatc
atgcttgccggtggacttgaattaaataataccaaagaagcagcgcaactcggctgctac
ggattagatttcaactcaggagtagaaagtactccgggtaaaaaagatcataaaaaatta
agcgccgtatttagcgcattacgagactattaa

DBGET integrated database retrieval system