KEGG   Aliivibrio fischeri MJ11: VFMJ11_1171
Entry
VFMJ11_1171       CDS       T00754                                 
Name
(GenBank) glutamate-gated potassium channel
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
vfm  Aliivibrio fischeri MJ11
Brite
KEGG Orthology (KO) [BR:vfm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vfm02000]
    VFMJ11_1171
Transporters [BR:vfm02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    VFMJ11_1171
SSDB
Motif
Pfam: SBP_bac_3 Lig_chan Lig_chan-Glu_bd 7TM-7TMR_HD Phosphonate-bd CPP1-like
Other DBs
NCBI-ProteinID: ACH65250
UniProt: B5FDH7
Position
I:1234836..1235936
AA seq 366 aa
MQGDRGKRLWYRGAVRLFSILLIFSSFFTQAQPQLKVGAYHCPPFIFESSAEQYDGLSMI
LWQRIAEIMQVEYKVSHYGLQELLSAAEVGEIDVGVSCISITPDREEHVDFSHSFYETHL
AIAVKNRSYLDSFISIITNKTLWKAIGIFLFVAISVGAFYYFLERKNNDKLYSMPTKRGR
IAEAFILGVLFITKGPFNYFEFKTLSARVVTVLIAMFSTVFIASITAVLASSLTLEQLRF
DVKGINDLSKVKTGAKQGTTASLLLSNHSIAHDTYKDMDSLLLALEEGKLDAVVADDAVL
RYMIKQGKSKELFLDLTVLPYQLEKQNYGLVLIENSPYEEKINRALLQVRETNEWHQILL
EYFAEK
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgcaaggagataggggaaagcgtttgtggtatagaggagcggttcgtttattctcaatt
ctattgatttttagttctttttttacacaagcacagccgcaattaaaggtgggtgcttat
cattgccctccatttatttttgaatctagcgcagagcagtatgacggtttgagtatgatt
ctttggcaacgtattgctgaaatcatgcaagttgaatacaaggtaagtcattatgggctt
caagagttactcagtgcggctgaagtaggtgaaatagacgtaggtgtttcttgcatatca
ataaccccagatcgtgaagagcatgtcgatttttcccattccttttatgaaactcacctt
gctatagcggttaaaaatcgaagttatcttgattcatttattagcattattactaataaa
accttatggaaggctattggtattttcttatttgttgcaatctcagtaggggcattttat
tacttcttagagcgtaaaaataacgataaattgtattcaatgcctacaaaacgaggacgt
atagctgaagcgtttattctgggtgttttgtttattactaaaggaccatttaattatttt
gaatttaaaacattatcggcaagagtggttacggtattaattgctatgttttctaccgta
tttattgccagtatcacggcagtactagcaagttcactcacattagagcagttaaggttt
gatgtaaaaggcattaatgatttatcaaaagtaaaaacgggggcaaaacaaggaacaacc
gcatcgttattgttgagtaaccacagcattgctcatgatacgtataaagacatggatagt
ttattgttagcactagaagaagggaagttagatgccgttgtcgctgatgatgccgtattg
cgatatatgattaagcaaggtaaatccaaggagttatttttagatttaacggtcttaccg
tatcaattagaaaaacaaaattacggtttagtgttaattgaaaatagtccttatgaagag
aaaattaatcgagcattattacaagttcgtgaaactaacgaatggcatcaaatattatta
gagtattttgctgaaaaataa

DBGET integrated database retrieval system