KEGG   Aliivibrio fischeri MJ11: VFMJ11_1881Help
Entry
VFMJ11_1881       CDS       T00754                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
vfm  Aliivibrio fischeri MJ11
Pathway
vfm00450  Selenocompound metabolism
vfm00970  Aminoacyl-tRNA biosynthesis
vfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    VFMJ11_1881 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    VFMJ11_1881 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vfm01007]
    VFMJ11_1881 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vfm03016]
    VFMJ11_1881 (metG)
Enzymes [BR:vfm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     VFMJ11_1881 (metG)
Amino acid related enzymes [BR:vfm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   VFMJ11_1881 (metG)
Transfer RNA biogenesis [BR:vfm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    VFMJ11_1881 (metG)
 Prokaryotic type
   Other AARSs
    VFMJ11_1881 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f FeoC DUF5068 PhnA_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: ACH66959
UniProt: B5FG53
Position
I:2001759..2003819
Genome map
AA seq 686 aa AA seqDB search
MATDPRKILVTCALPYANGSIHLGHMLEHIQADIWVRYQRLRGNDVNFICADDAHGTPIM
LKAQQMGISPEEMIAAVSEEHQKDFAGFDISFDNYHSTHSDENRELASHIYLELKKNGFI
TSRTISQLFDPEKEMFLPDRFVKGTCPKCKAEEQYGDNCDNCGETYSPTDLINPKSAVSG
ATPVMKDSEHFFFDLPQFESMLKEWTRSGSLQTETANKMQEWFESGLQQWDISRDAPYFG
FEIPGETNKFFYVWLDAPIGYMGSFKNLCNKRDDLNFDEYWKKDSTTELYHFIGKDIVYF
HSLFWPAMLDGAGFRKPNNVFVHGYVTVNGAKMSKSKGTFIKAGTYLNHLDPECLRYYYA
AKLNSRIDDLDLNLEDFTQRVNSDVVNKIVNLASRNAGFITKRFDGKLADNFAEPELYNE
FIAAADRIAELYETREFGRAIREITALADKANQYIDEKAPWVLAKEEGKEQELQEVSSVG
INLFRVLMAYLKPVMPELAARTEAFLNETLTWEGVAQPLVAHEITKFKALFARIDPKKVE
AMIEESKEDAAIEMAAKEKAEAEKEKASQTELDKDPIADEIEFDAFEAVDMRIARIISCE
EVPKANKLLKFQLDIGGETRQVFSGIKSAYKPEELEGKLTVMVANLKPRKMKFGMSEGMI
LAAGPGGKDLWILEPHEGAQPGMRVM
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggctacagatccgagaaaaattctggttacatgtgccctaccgtatgcaaacggttca
atccacttaggccacatgcttgagcatatccaagcggatatctgggttcgttaccaacgt
ttacgcggcaacgacgttaactttatttgtgcagatgatgctcacggcacaccaatcatg
cttaaagctcaacagatgggtatttctccagaagaaatgatcgcagccgttagcgaagag
caccaaaaagatttcgcaggctttgatatcagctttgataactatcacagcacgcacagt
gatgaaaaccgtgaattagcttctcacatctaccttgagctaaagaaaaacggctttatt
acaagtcgtacaatttctcagctgttcgatcctgaaaaagaaatgttcttaccagatcgc
tttgtaaaaggtacatgccctaaatgtaaagcagaagagcaatacggcgacaactgtgac
aactgtggcgaaacatacagcccaacagatttaattaatccaaaatcagccgtttctggt
gcaactccagtaatgaaagattctgagcatttcttctttgatcttcctcaatttgaaagc
atgcttaaagaatggactcgttcaggttctcttcaaactgaaactgcaaacaaaatgcaa
gagtggtttgaatcaggcttacagcaatgggatatctctcgtgatgcaccatactttggt
tttgaaatccctggcgaaacaaataaattcttctacgtttggctagatgctccaattggt
tacatgggttcattcaaaaacctatgtaataagcgtgacgatttaaactttgatgaatac
tggaagaaagacagcacaactgagctttatcacttcattggtaaagacattgtttacttc
cacagtctattctggcctgcaatgcttgatggcgcaggtttccgcaaaccaaataacgta
ttcgttcacggttacgtaacggttaacggtgcgaaaatgtctaaatctaaaggcactttc
attaaagctggtacttacttaaatcacttagaccctgagtgcctacgttactactatgcc
gcgaaactaaacagccgtattgatgatcttgatttaaaccttgaagatttcactcaacgt
gtgaattctgacgtagtaaacaagattgttaacctagcttctcgtaacgctggtttcatt
actaaacgctttgatggcaaacttgcagataactttgcagagcctgagctttacaatgaa
tttattgcagcagctgatcgtattgctgagctatatgaaactcgtgaatttggtcgtgct
atccgtgaaattacagcactagctgataaagcaaaccaatacattgatgaaaaagcacct
tgggttcttgcaaaagaagaaggtaaagagcaagagttacaagaagtatcttctgtaggc
attaacttgttccgtgtacttatggcttacttaaaacctgtaatgccagaacttgcagct
cgtacggaagcgttcttaaatgaaacactaacgtgggaaggcgttgcacaaccactagtt
gctcatgagatcactaagtttaaagcattatttgcgcgtattgatcctaagaaagttgaa
gctatgattgaagagtctaaagaagacgctgcaatcgaaatggcagcaaaagaaaaggca
gaagcggaaaaagaaaaagcaagtcaaactgagctagataaagatccaatcgcagatgag
attgagttcgatgcattcgaagcggttgatatgcgtattgcacgtattatctcttgtgag
gaagtaccaaaggcaaacaaactgcttaaattccaactagacatcggtggcgaaactcgt
caagtattctctggtattaaatcagcatacaaacctgaagagctagaaggcaagctaact
gttatggttgccaacctaaaacctcgtaaaatgaagtttggtatgtctgaaggcatgatc
ctagcagcaggccctggtggtaaagatctttggattttagaaccacacgaaggtgctcaa
cctggtatgcgtgtaatgtaa

DBGET integrated database retrieval system