KEGG   Aliivibrio fischeri MJ11: VFMJ11_2176Help
Entry
VFMJ11_2176       CDS       T00754                                 

Gene name
surE
Definition
(GenBank) 5'/3'-nucleotidase SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
vfm  Aliivibrio fischeri MJ11
Pathway
vfm00230  Purine metabolism
vfm00240  Pyrimidine metabolism
vfm00760  Nicotinate and nicotinamide metabolism
vfm01100  Metabolic pathways
vfm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vfm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    VFMJ11_2176 (surE)
   00240 Pyrimidine metabolism
    VFMJ11_2176 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    VFMJ11_2176 (surE)
Enzymes [BR:vfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     VFMJ11_2176 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE Adeno_hexon_C
Motif
Other DBs
NCBI-ProteinID: ACH65189
UniProt: B5FAF4
Position
I:complement(2315417..2316178)
Genome map
AA seq 253 aa AA seqDB search
MKKLRILLSNDDGVFAEGINTLARVLADIADITIVAPDRNRSGASNSLTLESPLRVRQID
EHIHSVQGTPTDCVHFALNELMKDNLPDLIIAGINHGANLGDDTLYSGTVAAATEGHFLG
LPAIAISLVGRDHFDTAAQVALKIVNNHLVSPLTTQKVLNVNVPDCEYEQLTGWEVTRLG
ARHHAESMIKDTDPRGETIYWLGPPGKKQDAGEGTDFFAVKQHRVSITPLQVDLTAHDSL
GMITDWLSLESSK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagttacgcattttgcttagtaacgatgatggtgtatttgctgaagggataaat
acgttagctcgtgtattagctgacattgccgatattacgatagtagctcctgatcgtaat
cgttctggcgcatcaaattctttaactcttgaatccccattacgtgttcgtcaaattgat
gaacacattcattcagtgcaagggacaccaacagattgtgttcactttgcattgaatgaa
ttaatgaaagataacttgcctgatttgattattgcaggtatcaatcatggagcaaactta
ggtgatgatactttgtactcaggtaccgtcgcggctgctactgaagggcactttttaggt
ttgcccgctattgctatctctttggttggacgcgatcattttgatacggcagctcaagta
gcattaaaaatagttaataaccatttagtttccccattaaccactcaaaaagtattgaat
gtgaatgtgccagattgcgaatacgagcaattaacgggctgggaagtgacacgattaggt
gcaaggcatcatgcagagagcatgattaaagatactgatcctcgtggtgagaccatctat
tggttaggccctccaggcaaaaaacaagatgcaggtgagggaacggacttctttgcagta
aagcagcaccgagtatcaataacaccattacaagtcgatttaactgctcatgattcatta
ggtatgattactgattggttatcattagagagttctaaataa

DBGET integrated database retrieval system