KEGG   Aliivibrio fischeri MJ11: VFMJ11_A0292Help
Entry
VFMJ11_A0292      CDS       T00754                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vfm  Aliivibrio fischeri MJ11
Pathway
vfm00620  Pyruvate metabolism
vfm00630  Glyoxylate and dicarboxylate metabolism
vfm01100  Metabolic pathways
vfm01110  Biosynthesis of secondary metabolites
vfm01120  Microbial metabolism in diverse environments
vfm01200  Carbon metabolism
Module
vfm_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VFMJ11_A0292
   00630 Glyoxylate and dicarboxylate metabolism
    VFMJ11_A0292
Enzymes [BR:vfm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VFMJ11_A0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParBc_2
Motif
Other DBs
NCBI-ProteinID: ACH63393
UniProt: B5ET31
Position
II:complement(330971..331531)
Genome map
AA seq 186 aa AA seqDB search
MAITNINKESNTQQEAPFMAEAVYAVEKMEAKQEEKQHQIKGLLDQLFPLTKGSHQDVTN
YLLDYHHLVVFFKDGSCSGLRNPGKFVAFTGHRSSPDTILLKDNSGSHVEIIFGLHTPGK
DSLVTIADVEIETCTTFSQDFSLAAMRHWISLIKRDNSSHIKAHQVDKEYTAKNGDEYQL
NSCFSL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaccaatataaacaaagaaagtaatacacaacaagaagctccgtttatggct
gaagctgtttacgccgtcgaaaaaatggaagcaaaacaagaggaaaagcaacatcaaatc
aaaggtcttcttgaccagttattcccattaacaaaaggttcacatcaagatgttactaac
tacttacttgattatcatcatttagtggttttctttaaagatggtagttgcagtggatta
cgtaatccaggaaaattcgtcgcttttacaggacacagatcatcgcctgatactattcta
ttaaaagataacagtggcagtcatgttgaaattatttttggtttgcatactccaggcaaa
gattcactggttaccatcgctgatgtagaaatagaaacatgcacaacatttagccaagac
tttagcttagcggctatgcgccattggattagtttaataaagcgtgataacagttcgcac
attaaagctcatcaagttgataaagaatatacagccaaaaatggagatgaataccaactt
aacagctgctttagtctctaa

DBGET integrated database retrieval system