KEGG   Aliivibrio fischeri MJ11: VFMJ11_A0544Help
Entry
VFMJ11_A0544      CDS       T00754                                 

Definition
(GenBank) Low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vfm  Aliivibrio fischeri MJ11
Pathway
vfm00260  Glycine, serine and threonine metabolism
vfm01100  Metabolic pathways
vfm01110  Biosynthesis of secondary metabolites
vfm01120  Microbial metabolism in diverse environments
vfm01130  Biosynthesis of antibiotics
vfm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vfm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VFMJ11_A0544
Enzymes [BR:vfm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     VFMJ11_A0544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP YlmH_RBD
Motif
Other DBs
NCBI-ProteinID: ACH64151
UniProt: B5ETS5
Position
II:complement(621748..622752)
Genome map
AA seq 334 aa AA seqDB search
MIDFRSDTVTRPTPNMREAIANALVGDDVYGDDPTTNELEQWAAERHGFEAAMFTSSGTQ
ANLLGLMAHCERGDEYLCGQQAHNYKYEAGGAAVLGSIQPQPIENNPDGTLCFEKLAAAI
KADDFHFARTKLLSLENTINGKVLPLSYLAQAREFVDKHQLALHLDGARVYNAAVALDVD
IKEIAQHFDSMTICLSKGLSAPIGSLLLGTKEYIKKARRIRKMLGGGMRQTGILAAAGKL
ALTEQVPQLAVDHANAKYLAEQLNTVNGFSVNVEHIQTNIVFAKLGDKVDIKTICDKALK
QDILLSAGNPIRFVTHKDITKQNIDTLIEFLKQN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgattgattttcgctctgatacagttactcgcccaacaccaaatatgcgtgaagctatc
gctaacgctctggttggtgatgatgtttatggagatgacccaaccacaaacgaattagaa
caatgggctgctgagcgccatggttttgaagcggcaatgttcacttcatcaggaacacaa
gcaaacctattagggcttatggctcactgtgaacgtggagatgagtatttgtgtggccaa
caagcccataactataaatatgaagctggtggtgcagcagtattagggtcaatccaacca
cagccgattgaaaataatcctgatggtactttatgcttcgaaaaactggctgctgcaata
aaagcggatgacttccattttgctagaaccaaactattgagcttagaaaacaccattaat
ggcaaggttcttccgttaagctacctagctcaagctcgagaatttgtggacaaacatcaa
cttgctctgcatttagatggagctcgcgtctataatgccgcagttgcgttagatgttgat
ataaaagagattgctcaacattttgatagtatgacaatttgtttatcaaaaggcctatca
gcaccaattggttctttactacttggcacaaaagaatacatcaaaaaagctcgccgtatt
agaaaaatgctgggaggcggtatgcgccaaacgggcattcttgctgcagcgggaaaactc
gcattaaccgagcaagtgccacaactggccgtggaccatgccaatgctaaatatttagct
gaacagttaaatacggtaaatggattttcagtgaatgttgagcatattcaaaccaatatt
gtttttgctaaattaggtgacaaagtagatatcaaaaccatttgtgataaagcacttaaa
caagatattttgctttctgctggcaaccctattcgctttgtgactcataaagacatcaca
aaacaaaatattgataccttaattgagttcttaaaacagaactaa

DBGET integrated database retrieval system