KEGG   Aliivibrio fischeri MJ11: VFMJ11_A0831
Entry
VFMJ11_A0831      CDS       T00754                                 

Definition
(GenBank) BfdA
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vfm  Aliivibrio fischeri MJ11
Pathway
vfm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vfm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VFMJ11_A0831
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vfm02044]
    VFMJ11_A0831
Secretion system [BR:vfm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VFMJ11_A0831
SSDB
Motif
Pfam: T6SS_HCP TssD DUF4791
Other DBs
NCBI-ProteinID: ACH63978
UniProt: B5EUL2
Position
II:complement(918192..918710)
AA seq 172 aa
MPTPAYMSIKGETQGDITKDAYSADSVGNVWQEAHVDEFLVQELDHVLTVPRDPQSGQPT
GQRVHRPVVVTKQQDRCSPLLFNSLVSGEKLPECNIKFYRTSTSGKQEHYYTIKLIDALL
VDMQTRMAHCQDAAMSDRVTEEVLKFTYRAIEVTHETCGTAGNDDWRTPREA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccagcatatatgtcaattaaaggtgaaactcaaggcgatattactaaagat
gcttattcagcagattcagttggtaacgtatggcaagaagcacacgttgatgaattcctt
gttcaagaacttgaccatgttttaactgttccacgtgatcctcaaagtggtcaaccaact
ggtcaacgtgtacaccgtcctgtagttgtaactaaacaacaagaccgttgttctccatta
ctatttaactcattagtgtctggtgaaaaacttcctgagtgtaatattaaattctaccgt
acgtcgacttcaggtaagcaagagcattactacacaatcaaactgattgatgcactacta
gttgatatgcaaactcgtatggctcactgccaagatgctgcaatgtctgatcgtgtaact
gaagaagtgcttaagtttacttaccgtgcaattgaagtgactcacgaaacatgtggcact
gctggtaatgacgactggcgtacaccacgcgaagcgtaa

DBGET integrated database retrieval system