KEGG   Vibrio furnissii: vfu_A00313Help
Entry
vfu_A00313        CDS       T01680                                 

Definition
(GenBank) chromosomal replication initiation protein
  KO
K02313  chromosomal replication initiator protein
Organism
vfu  Vibrio furnissii
Pathway
vfu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    vfu_A00313
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vfu03032]
    vfu_A00313
   03036 Chromosome and associated proteins [BR:vfu03036]
    vfu_A00313
DNA replication proteins [BR:vfu03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    vfu_A00313
Chromosome and associated proteins [BR:vfu03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    vfu_A00313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA AAA_14 AAA_16 AFG1_ATPase NACHT ATPase_2 DUF815 Kinesin AAA_19 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ADT85540
UniProt: F0LQ67
Position
1:complement(340647..342053)
Genome map
AA seq 468 aa AA seqDB search
MSSSLWLQCLQQLQEELPAAEFSMWVRPLQAELNDNTLTLFAPNRFVLDWVRDKYINNIN
RLLKDFCGHDVPSLRFEVGSRRVVAPKPTQKRTAADVAAESSAPAQLAQRKPIHKTWDDD
AANAPEITYRSNMNPKHKFNNFVEGKSNQLGLAAARQVSDNPGAAYNPLFLYGGTGLGKT
HLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQF
FANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPEL
ETRVAILMKKAEDHQIHLPDEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFV
REALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALSKELTN
HSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLIRTLSS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcttcgctttggttgcagtgcctgcaacagcttcaagaggagctaccagccgca
gaattcagcatgtgggttcgtccgttacaagcggagctcaatgacaatactctcactttg
tttgcacccaaccgctttgtgctcgattgggttcgcgacaaatacatcaacaacatcaac
cgcctgttgaaagacttttgcggtcatgatgtgccgagcctacgttttgaagtgggcagc
cgccgggtggtggcgccaaaaccgactcaaaaacgtaccgctgcggatgtggcggcagag
tcttctgcgcctgcgcaactggcgcaacgtaaaccgattcacaaaacctgggatgatgat
gcggccaatgcgccggaaattacctatcgttccaacatgaatccaaagcacaaattcaat
aactttgtcgaaggtaagtcgaaccagctcggccttgcggctgcgcgtcaggtctccgac
aatccgggggcggcttacaacccactgtttttatacggcgggaccggtttgggtaaaacg
cacttgctgcatgcggtgggcaacgccatcgtcgacaacaacccgaacgccaaagtggtc
tacatgcactcggaacgtttcgtgcaggacatggtgaaagcgctgcaaaacaacgcgatt
gaagagttcaaacgctattaccgcagtgtggatgcactcctgatcgatgacattcaattc
tttgccaataaagagcgttcgcaagaagaatttttccatactttcaacgcgttgttggaa
ggaaaccagcaaatcattttgacatccgaccgttatccaaaagagatcaacggggtggaa
gatcgcctcaaatcccgctttggctgggggctgactgttgcgatcgagccaccagagctg
gaaacgcgcgtcgcaatcttgatgaaaaaagccgaagatcaccaaattcatctgccggat
gaagtggcgttctttattgcaaaacgtctgcgttcaaacgtgcgtgagttggaaggggcg
ctgaaccgcgtgattgccaacgccaactttaccggtcgcccgatcaccatcgatttcgtg
cgtgaagcactgcgcgatctgttggcactgcaagagaaactggtcaccatcgacaacatt
caaaagaccgttgccgaatactacaagattaaagtcgcggatctgctctccaaacgtcgt
tcacgctcagtggcgcgccctcgtcaattggcgatggcactgtcgaaagagctgaccaac
cacagcttgccggaaatcggtgacgcgtttgggggccgtgaccacacgaccgtgctgcat
gcgtgtcgtaagatcgaacaactgcgcgaagaaagccacgatattaaagaagactattcg
aacctgattcgaaccctgtcttcgtaa

DBGET integrated database retrieval system