KEGG   Vibrio furnissii: vfu_A00432Help
Entry
vfu_A00432        CDS       T01680                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vfu  Vibrio furnissii
Pathway
vfu00860  Porphyrin and chlorophyll metabolism
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01120  Microbial metabolism in diverse environments
Module
vfu_M00121  Heme biosynthesis, glutamate => heme
vfu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    vfu_A00432
Enzymes [BR:vfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     vfu_A00432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADT85653
UniProt: F0LQY7
Position
1:complement(458700..459428)
Genome map
AA seq 242 aa AA seqDB search
MAVLVTRPEAQGQALCQQLAQCGIHALHHPLITLKAGADLPQLLPALHQCDLLIAVSQHA
VTFTHQFLQSERSCWPTSAIYLAVGQKTAHVLSKLSAQPVHYPDISDSEHLLALPALHAV
QGKSVIILRGNGGRELIFDTLVARGAHVSYREVYQRVDLPFASEACVATWQQAGVDTLVI
TSSHQLMFFVSQLTATSLSWALGLKLLVPSDRIAHDAKALGFQTIVTTGSAANPDLVAAL
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcttggtgacgcgccccgaggcgcagggacaagcgttgtgtcagcagttggca
caatgtgggattcatgccctccaccacccattgatcactctgaaggcaggcgccgacctg
cctcagctgctgcccgccctgcaccaatgtgatctgctgatcgccgtgagtcagcatgcc
gtgacatttacccaccagtttttgcaatctgagcgatcttgctggccaacttccgccatt
taccttgccgttggtcaaaaaactgcacacgttttaagcaaactttctgcacaaccagta
cactacccggacatcagcgacagcgaacatttattggcactgccagccctgcacgcggtg
cagggaaaatcagtcatcattttgcgtggcaacggcgggcgcgagctgattttcgacaca
ttggtcgcacgtggcgcgcacgtcagttaccgcgaagtgtaccaacgcgtggatttacca
tttgccagtgaggcctgcgtcgctacatggcaacaagcgggcgtggatacgctggtgatt
accagcagccaccagctgatgttttttgtttcacaactgaccgcaaccagcctgagctgg
gcgcttggtctgaaattactggtacccagtgatcgaatcgcccacgatgccaaagccttg
ggatttcaaaccatcgtgaccacaggaagtgcggcgaacccagatttagtggcggctctc
cagccctaa

DBGET integrated database retrieval system