KEGG   Vibrio furnissii: vfu_A01958
Entry
vfu_A01958        CDS       T01680                                 

Definition
(GenBank) hcp protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vfu  Vibrio furnissii
Pathway
vfu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vfu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    vfu_A01958
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vfu02044]
    vfu_A01958
Secretion system [BR:vfu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   vfu_A01958
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ADT87115
Position
1:complement(2054423..2054941)
AA seq 172 aa
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHIVTVPTDPQSGQPS
GQRVHKPFKFTVSLNKAVPLLYNALASGEKMTTVELKWYRTSIEGKQENFFTTKLENASI
VDIQCEMPHCQDPAKSDFTQNLTVSMSYRKITWDHVNAGTSGSDDWRKPVEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccatgttatatctctatcgaaggtcaaactcagggtcttatcactgcaggc
gcttgtactgcggattctatcggcgattcattcgttgaaggtcatgaagacgaaatgctg
gttcagcagttcgaccacattgtcaccgtaccaactgacccacaatcaggtcagccttca
ggtcaacgtgtgcacaaaccattcaaattcaccgtgtctctgaacaaagccgttcctctg
ctgtacaacgcactggcttcaggcgagaagatgacgactgttgaactgaaatggtaccgc
acgtctatcgaaggcaaacaagaaaacttcttcaccaccaagctggaaaacgcgtctatc
gtggatatccaatgtgaaatgccacactgccaagatccagcaaaatctgatttcactcag
aatctgactgtttcgatgtcttaccgcaaaatcacgtgggatcacgtgaacgcgggtact
tcaggctcagacgattggcgtaaaccagtcgaagcgtaa

DBGET integrated database retrieval system