KEGG   Vibrio furnissii: vfu_A01972Help
Entry
vfu_A01972        CDS       T01680                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
vfu  Vibrio furnissii
Pathway
vfu00360  Phenylalanine metabolism
vfu00362  Benzoate degradation
vfu00620  Pyruvate metabolism
vfu00621  Dioxin degradation
vfu00622  Xylene degradation
vfu00650  Butanoate metabolism
vfu01100  Metabolic pathways
vfu01120  Microbial metabolism in diverse environments
vfu01220  Degradation of aromatic compounds
Module
vfu_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    vfu_A01972
   00650 Butanoate metabolism
    vfu_A01972
  Amino acid metabolism
   00360 Phenylalanine metabolism
    vfu_A01972
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    vfu_A01972
   00622 Xylene degradation
    vfu_A01972
   00621 Dioxin degradation
    vfu_A01972
Enzymes [BR:vfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     vfu_A01972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3 2-Hacid_dh_C F420_oxidored GFO_IDH_MocA Shikimate_DH CoA_binding
Motif
Other DBs
NCBI-ProteinID: ADT87128
UniProt: F0LUB3
Position
1:complement(2067199..2068134)
Genome map
AA seq 311 aa AA seqDB search
MNKLNVAIIGSGNIGTDLMIKVLRNSQYLNMSVMVGIDPESDGLARARRMGVATTHEGVD
GLIAMAEFEHIDIVFDATSANAHIKNDAALRHVKPGIKLIDLTPAAIGPYCVPVVNLEQN
LAQNNVNMVTCGGQATIPVVAAVSQVATVHYAEIIASISSKSAGPGTRANIDEFTETTSQ
AIETVGGAKKGKAIIILNPAEPPLMMRDTVHVLCDSNDQAKVRASIEEMVSAVQSYVPGY
RMKQDVQFEVIEKDAPLTLPGYGKFSGLKVSVFIEVEGAAHYLPAYAGNLDIMTCAAMAT
AERMAQSRLNQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagctgaatgtagcgatcattggttccggtaacatcgggacggatctgatgatc
aaagtccttcgaaatagccaatacctgaacatgagcgtcatggtcgggattgacccagaa
tccgatggactggcacgcgcacgccgcatgggcgtagcaaccacacacgaaggtgtggac
ggtctgattgcgatggctgaatttgagcacatcgacattgtatttgatgcaacatctgcg
aacgcgcacatcaaaaatgatgcagcgcttcgccatgtgaagcccggcatcaaactcatc
gacctgacgccagccgccatcggcccctattgtgtccctgtggtgaacctagagcagaac
ctcgcgcagaacaacgtcaacatggtgacgtgtggtgggcaggcgacgattccggtcgtt
gcggcggtttcgcaagtggctaccgtccattatgccgagatcattgcgtcgatcagcagt
aaatcagcaggcccaggcacacgcgccaacattgatgagtttaccgaaaccacatcgcaa
gcgattgaaacggtcggcggggcgaaaaaagggaaagcgatcatcattcttaacccggca
gagccaccgctcatgatgcgcgataccgtgcatgtgctgtgtgattcaaacgatcaagcc
aaggtgagagcctcaattgaagagatggtgagcgcggtacaaagctacgtgccgggttat
cgcatgaagcaagacgtgcagtttgaagtgatcgagaaagatgcgccgctcacgttgcca
ggttacggcaaattcagcggcctgaaagtgtcggtatttattgaagtagaaggcgcagct
cattacctgccagcgtacgcgggcaacctcgatattatgacttgtgctgccatggcgacg
gctgagcgtatggctcaatcgcgactcaatcaataa

DBGET integrated database retrieval system