KEGG   Vibrio furnissii: vfu_A03073Help
Entry
vfu_A03073        CDS       T01680                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
vfu  Vibrio furnissii
Brite
KEGG Orthology (KO) [BR:vfu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    vfu_A03073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 DUF3859
Motif
Other DBs
NCBI-ProteinID: ADT88181
UniProt: F0LWP2
Position
1:3208511..3208891
Genome map
AA seq 126 aa AA seqDB search
MDISNPCIKIQVHTKYIPEQSNPEYQRYVFAYLITIKNLSNENVQLISRRWLITDSNGKQ
MTVEGDGVVGEQPVIPANDEYTYSSGTALETPVGVMQGHYIMHNQAGEEFIADIEPFRLA
VPNVLN
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatatttccaatccttgtatcaagattcaggttcacaccaaatacattcctgaacaa
tccaaccctgaataccagcgttatgtgttcgcctatctgatcacgattaaaaacctcagc
aatgaaaacgtacaactgatcagccgtcgctggctcatcactgattccaacggcaaacag
atgactgtggaaggtgatggcgtggtcggagaacaacccgtgattccagccaatgacgaa
tatacctacagtagcggcaccgcgctggaaaccccggttggcgtcatgcaaggccactac
atcatgcacaatcaagcgggtgaggaatttattgccgatatcgagccattccgcctcgcg
gttcccaacgtcctcaattaa

DBGET integrated database retrieval system