KEGG   Vibrio furnissii: vfu_B00320Help
Entry
vfu_B00320        CDS       T01680                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vfu  Vibrio furnissii
Pathway
vfu00071  Fatty acid degradation
vfu00072  Synthesis and degradation of ketone bodies
vfu00280  Valine, leucine and isoleucine degradation
vfu00310  Lysine degradation
vfu00362  Benzoate degradation
vfu00380  Tryptophan metabolism
vfu00620  Pyruvate metabolism
vfu00630  Glyoxylate and dicarboxylate metabolism
vfu00640  Propanoate metabolism
vfu00650  Butanoate metabolism
vfu00900  Terpenoid backbone biosynthesis
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01120  Microbial metabolism in diverse environments
vfu01130  Biosynthesis of antibiotics
vfu01200  Carbon metabolism
vfu01212  Fatty acid metabolism
vfu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    vfu_B00320
   00630 Glyoxylate and dicarboxylate metabolism
    vfu_B00320
   00640 Propanoate metabolism
    vfu_B00320
   00650 Butanoate metabolism
    vfu_B00320
  09103 Lipid metabolism
   00071 Fatty acid degradation
    vfu_B00320
   00072 Synthesis and degradation of ketone bodies
    vfu_B00320
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    vfu_B00320
   00310 Lysine degradation
    vfu_B00320
   00380 Tryptophan metabolism
    vfu_B00320
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    vfu_B00320
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    vfu_B00320
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    vfu_B00320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vfu04147]
    vfu_B00320
Enzymes [BR:vfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     vfu_B00320
Exosome [BR:vfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   vfu_B00320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADT88563
UniProt: F0LXB4
Position
2:complement(320619..321824)
Genome map
AA seq 401 aa AA seqDB search
MEKVFIVAAKRSPIGAFGGTLKNVPAGKLAADVIKGALQAGNVDVNHVDEVIIGHVISAG
QGMGVGRQAAMFAGIPEEVPAYGVNMVCGSGMKTVMDAVAHIRAGDISVAVAGGVEVMSQ
IPFVTPSSLRDGQKMGGFEMKDLLINDGLTDVFNQYHMGVTAENIAKQFEITRDAQDAFA
LESQQKAVAAIEAGKFNDEIVPIAVQQRRDTITFFVDEYPKAGATLAGLQGLRPAFDKEG
SVTAGNASGINDGASAIIVASQSAVDEYGFEPLAEILGYAQTGIDPRVMGLGPVSAVTQA
LEKAELGIDQIDLFELNEAFAAQALGVVHGLSAEHNVSTDSILAKSNVNGGAIALGHPLG
ASGNRILVTLVHELKRRGNDYGVASLCVGGGMGTAIVIKAL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtatttattgttgctgccaaacgcagcccaattggtgcctttggcggaacg
ttgaaaaatgtacccgctggcaagttggccgccgatgtcatcaaaggcgcgctacaggca
ggtaatgtcgatgtaaatcacgttgatgaagtgatcatagggcatgtgatcagtgccggt
caaggaatgggcgtggggcgtcaagccgccatgtttgccggtattcccgaggaagtccca
gcgtatggcgtcaatatggtgtgtggcagtggcatgaaaacggtcatggatgcggtggcg
catattcgtgctggcgacatttcggtggccgtcgccggtggtgtggaagtgatgtcacaa
atcccgtttgtgacaccgagttccctgcgcgatggccaaaaaatgggcggctttgaaatg
aaagatctgctcatcaacgatggtttaaccgatgtgttcaaccaataccacatgggcgtg
actgcagagaatatcgccaagcaatttgagatcacgcgtgatgcgcaagatgcgtttgcg
ctagagagtcagcaaaaagcagtcgcagccattgaagcgggcaagttcaacgatgagatt
gtccccatcgccgtgcaacagcgccgtgacaccatcacttttttcgtcgatgagtacccc
aaagcgggtgcaacgctcgctggtctgcaagggttgcgtcctgcgtttgataaagaaggc
tcggtgacggctggcaatgcgtcgggcatcaatgatggtgccagtgcaatcatcgtcgca
tcacaatcggcggttgacgagtatggttttgaacccttggcggaaatcttgggttatgcc
caaaccggtatcgatccgcgcgtcatggggcttggtcctgtcagtgcggtgacacaagcg
ctggaaaaagcagagctgggcatcgatcaaattgacctatttgagctcaatgaagccttt
gccgctcaggcattaggagtggttcacgggttgtcggcggaacataacgtgtcaaccgat
tccattttggccaagtcgaatgtcaatgggggcgcaatcgccctcgggcatccgctgggc
gcgtcaggtaaccgcattctggttacgttagttcacgagttaaaacgtcgcggtaacgat
tacggtgtagcatccctgtgtgtgggtggtggcatgggtacggcgatcgttattaaagcg
ttgtaa

DBGET integrated database retrieval system