KEGG   Vibrio furnissii: vfu_B00878Help
Entry
vfu_B00878        CDS       T01680                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
vfu  Vibrio furnissii
Pathway
vfu00051  Fructose and mannose metabolism
vfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    vfu_B00878
Enzymes [BR:vfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     vfu_B00878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UPF0052 Sacchrp_dh_NADP ApbA
Motif
Other DBs
NCBI-ProteinID: ADT89085
UniProt: F0LYT6
Position
2:913020..914168
Genome map
AA seq 382 aa AA seqDB search
MKNAVHFGAGNIGRGFIGKLLADADVAVTFADVNAPLVDQLSHKQEYKVKVVGTECQIDT
VTHVTAVNSASEDVIDRIVNTDLVTTAVGPNVLDIIAKTIAQGIAKRFEVGNEAPLNIIA
CENMVRGTTHLKGEVYKHLDAALHAKADALIGFVDSAVDRIVPPAEAANDDPLEVTVESF
SEWIVDEQQFKGEIPTIAGMEKTDNLMAFVERKLFTLNTGHCITAYLGCLSGHRTIREAI
EDPAIRTQVKQAMQESGEVLIRRYGFDRDMHNAYIDKILGRFANPYLVDEVDRVGRQPIR
KLGPNDRLVKPLLGTIEYGTENKTLLKGIAAALKYTNDSDPQAVELQTSLSQHGVTQTVA
HYTGLDEHSAEVQTIASLYNQL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagtacattttggcgcaggcaacatcggtcgtggcttcattggtaaactt
ctcgcagacgccgacgtggccgtcacgttcgccgacgtgaacgccccgctcgtcgaccag
ctcagccacaaacaagagtacaaagtgaaagtggtcggcactgaatgccaaattgacacc
gtcacgcacgtcaccgccgtgaactctgccagcgaagacgtcatcgaccgcatcgtcaac
accgatttggtcaccaccgccgtaggcccaaacgtgctcgacatcatcgccaaaaccatc
gcccaaggcatcgccaaacgctttgaggtcggcaatgaagcgcccctcaatatcatcgcg
tgcgagaacatggttcgcggcaccacacacctgaaaggtgaagtctacaaacacctcgat
gcagccttgcacgccaaagctgacgcgctgattggctttgttgattcagccgtcgaccgc
attgtgccaccggcagaagcggccaacgacgacccactggaagtgactgtggaaagcttt
agtgaatggattgtcgatgagcaacagttcaaaggcgagattccaaccatcgccggcatg
gaaaaaaccgataacctgatggcgtttgtcgagcgtaaactgttcaccctcaacaccggt
cactgcatcaccgcgtatttgggttgtctgagtggccatcgcaccattcgcgaagcgatt
gaagatccagccattcgcacgcaagtgaaacaggccatgcaagagagcggtgaagtgctg
atccgccgttacggcttcgatcgcgacatgcacaacgcgtacatcgacaagattctcggc
cgctttgccaacccgtacttggtggatgaagtggatcgcgtcggccgtcagccaattcgc
aaattgggtccaaatgatagattagtgaagccattactgggtacaatcgagtatggcact
gaaaataaaacacttttgaaaggcatcgccgccgcattgaaatacaccaatgacagcgat
ccacaagctgtcgaactgcaaacgtcgctcagccagcacggcgtcactcaaacagtggcc
cactacaccggtctggatgaacacagcgcagaagtgcagaccattgcgtcgctttacaac
caactctaa

DBGET integrated database retrieval system