KEGG   Vibrio furnissii: vfu_B01010
Entry
vfu_B01010        CDS       T01680                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vfu  Vibrio furnissii
Pathway
vfu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vfu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    vfu_B01010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vfu02044]
    vfu_B01010
Secretion system [BR:vfu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   vfu_B01010
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ADT89210
Position
2:1055989..1056507
AA seq 172 aa
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHIVTVPTDPQSGQPS
GQRVHKPFKFTVSLNKAVPLLYNALASGEKMTTVELKWYRTSIEGKQENFFTTKLENASI
VDIQCEMPHCQDPAKSDFTQNLTVSMSYRKITWDHVNAGTSGSDDWRKPVEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccatgttatatctctatcgaaggtcaaactcagggtcttatcactgcaggc
gcttgtactgcggattctatcggcgattcattcgttgaaggtcatgaagacgaaatgctg
gttcagcagttcgaccacatcgtcactgtaccgactgacccacaatcaggtcagccttca
ggtcaacgtgtgcacaaaccattcaaattcactgtgtctctgaacaaagccgttcctctg
ctgtacaacgcactggcttcaggcgagaagatgacgactgttgaactgaaatggtaccgc
acgtctatcgaaggcaaacaagaaaacttcttcaccaccaagctggaaaacgcgtctatc
gtggatatccagtgtgaaatgccacactgtcaagatccagcaaaatctgatttcactcag
aacctgactgtttcgatgtcttaccgcaaaatcacgtgggatcacgtgaacgcgggtact
tcaggctcagacgattggcgtaaaccagtcgaagcgtaa

DBGET integrated database retrieval system