KEGG   Vibrio furnissii: vfu_B01190Help
Entry
vfu_B01190        CDS       T01680                                 

Definition
(GenBank) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
vfu  Vibrio furnissii
Brite
KEGG Orthology (KO) [BR:vfu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vfu02044]
    vfu_B01190
Secretion system [BR:vfu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   vfu_B01190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N Cytochrom_B562
Motif
Other DBs
NCBI-ProteinID: ADT89378
UniProt: F0LZM9
Position
2:1252090..1253367
Genome map
AA seq 425 aa AA seqDB search
MSNILFIDNAYYRLTNDTDAIRQLDVYQKIRDEINRRFNPLAGGTDWEVVRESCDALAKR
AGLDLLMCGYFAVANLKTVGLAGYANGLELLSVSLSNQSQPDVKTAKMRKEVLDWVNARV
VQELKDLKPNYESLRDLYRCERFCERIHHQLERQQPEYLVDFEGVGFALFEHIDRIETQY
HSLVKRQHQQAGDAEPQVQRRVHRMRLSLAFVTGCVLSVGAVWAYQVIPWFHTSDYAMRV
EVATLSSDDARRHFQQSVSDNQIARWKSNLVPLYEQSIGQKSAISMEQSKREAMHEMATL
RTLYPDDEQIKTSDEAFSAAQRAALEQTELFVQRFGEIRTKMANISLLAKREKWRDLQRQ
TKSLEDFAVSLSPVYGRVDYVQNLIKQGELESARKELEILKTRLNNLSWTMAQLEESLSG
QPIAQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacattttatttattgataacgcttactatcgtttgaccaatgacaccgatgcc
attcgtcaactggatgtttaccagaaaatcagagatgagattaaccgtcgatttaatccg
ttagcggggggaaccgattgggaagtcgtgcgcgaatcttgtgacgcgttggcaaagcgt
gccgggctggacctgttgatgtgcggttactttgcggtcgccaatctaaaaacggtggga
ttagcggggtatgccaacgggttggaattactgagtgtcagtttgagcaatcaaagtcag
ccggatgtgaaaaccgccaagatgcgtaaagaagtcttggattgggtcaacgcccgagtg
gtgcaggagctcaaagacctgaagcccaactacgaatcgctacgcgatttatatcgttgc
gaacgtttttgcgaacgtatccaccatcagcttgagcggcagcaaccggagtatttggtg
gatttcgaaggcgtcgggtttgcgctctttgaacacatcgaccgcattgaaacccaatat
cacagcctagtgaaacggcaacaccaacaggcgggggacgcagagccacaagtgcagagg
cgagtgcatcgcatgcgattgtcgctggcctttgtgacgggttgtgttttgtctgtgggc
gcggtgtgggcatatcaggtgattccgtggtttcacaccagcgattacgccatgcgtgtt
gaggtcgcgacgctcagcagtgacgatgcgcgccgccattttcaacagtctgtgtctgac
aatcaaattgcacgttggaaaagcaatctggtgccactttatgagcaatcaatcgggcaa
aaaagcgctatttcgatggaacagagcaaacgcgaagcgatgcatgaaatggcaacacta
cgcacactctatccagatgatgagcaaattaaaacaagcgatgaagcgtttagtgcagcg
cagcgagctgcactggagcaaacagaactgtttgtgcagcgatttggtgaaattcgtacc
aagatggccaatatttcgctgttggccaagcgcgaaaaatggcgtgatttacagcgccag
accaaatcgttggaagattttgctgtgagtttgtcgccggtctatggccgggtcgattat
gtgcagaatctgattaagcaaggcgaactcgaatcggcgcgcaaagagttggagattctg
aaaactcgtctcaataatttgagctggacgatggctcaactggaagagtcgttgagtggg
cagccaatcgcgcaatag

DBGET integrated database retrieval system