KEGG   Vibrio furnissii: vfu_B01428Help
Entry
vfu_B01428        CDS       T01680                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vfu  Vibrio furnissii
Pathway
vfu00071  Fatty acid degradation
vfu00072  Synthesis and degradation of ketone bodies
vfu00280  Valine, leucine and isoleucine degradation
vfu00310  Lysine degradation
vfu00362  Benzoate degradation
vfu00380  Tryptophan metabolism
vfu00620  Pyruvate metabolism
vfu00630  Glyoxylate and dicarboxylate metabolism
vfu00640  Propanoate metabolism
vfu00650  Butanoate metabolism
vfu00900  Terpenoid backbone biosynthesis
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01120  Microbial metabolism in diverse environments
vfu01130  Biosynthesis of antibiotics
vfu01200  Carbon metabolism
vfu01212  Fatty acid metabolism
vfu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    vfu_B01428
   00630 Glyoxylate and dicarboxylate metabolism
    vfu_B01428
   00640 Propanoate metabolism
    vfu_B01428
   00650 Butanoate metabolism
    vfu_B01428
  Lipid metabolism
   00071 Fatty acid degradation
    vfu_B01428
   00072 Synthesis and degradation of ketone bodies
    vfu_B01428
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    vfu_B01428
   00310 Lysine degradation
    vfu_B01428
   00380 Tryptophan metabolism
    vfu_B01428
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    vfu_B01428
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    vfu_B01428
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    vfu_B01428
Enzymes [BR:vfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     vfu_B01428
Exosome [BR:vfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   vfu_B01428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF2285
Motif
Other DBs
NCBI-ProteinID: ADT89606
UniProt: F0M0J4
Position
2:1511161..1512381
Genome map
AA seq 406 aa AA seqDB search
MEKAIWIVSAKRTPQGRFQGALKEYTAPQLGGAAIKAALNDTSAPIEQVDEVLMGCVLPA
GCGQAPARQAALNAGLPLSVGATTINKVCGSGMKAVMLAHDLIKAGSAQCIIAGGMESMT
NAPYLLSNARSGMRMGHQTTFDHLFLDGLQDAYDGHLMGVFAQQIADKLEFSREAMDEWA
ALSAQRAWEAQEQQLFVAEMTPLTFGKQAELLDYDEHPRAIKLDKIPQLKPAFAEDGSVT
AANSSAIADGAAALMLMDEDSARSQGLEPLAVIRGHATHARLPAEFTLAPVYAIEQLLSQ
LDWTVDEIDLWEINEAFAVVTQIAVQQLGLDVDKVNVKGGACALGHPIGASGARILVTLL
HSLRQLQALGVNGDKSQQKVMRGVASLCIGGGEATAIAIEIPLPEA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcgatctggattgtatctgccaaacgaacgccgcaagggcgttttcaggga
gcattgaaagagtacaccgcgccgcaactgggcggagcggccattaaagcggcattgaac
gacacatcggcccccattgagcaagtcgatgaagtgctcatgggctgcgttctgcctgcc
gggtgcggccaagcgcctgcaaggcaagcggcgctgaatgcgggcctgccgctctcggtg
ggggcaaccaccatcaataaagtgtgtggctctggcatgaaagccgtgatgctggcgcat
gacctcatcaaagcgggcagcgcgcaatgcattattgcgggcgggatggagagcatgacc
aatgcgccgtacctgctgagcaacgctcgcagtggcatgcgaatgggccaccaaacgacc
tttgatcacctatttctcgatggattgcaggatgcctacgacgggcacctgatgggcgta
tttgcccagcagatcgccgacaaacttgagttcagtcgcgaagcgatggacgaatgggca
gcgctgtctgcgcaacgtgcctgggaagcacaagagcagcaactctttgtcgctgaaatg
acgccgctgacgtttggtaaacaggccgaattgctcgattacgacgaacatccgcgcgcc
atcaagctcgacaaaatcccacagctcaaacccgcctttgccgaagatggtagtgtcacg
gcggccaactccagcgccatcgccgatggtgctgctgccttgatgttgatggatgaagac
tctgcgcgttcgcaaggtttggagcctttagccgtgattcgcggccacgctacgcacgcc
agattgccagcagaatttaccctggcgccggtgtacgctatcgaacaactgctgtcgcag
cttgactggacggtggatgaaatcgatctgtgggagattaacgaagcgtttgcggtggtc
acccaaatcgctgtgcagcagctcgggctggatgtcgacaaagtgaatgtcaaaggcggt
gcctgtgcgctgggtcacccgatcggggccagtggcgcgcgcattctggtcacgttgctc
cacagcctgcgtcagttgcaggcgctgggtgtcaacggcgataaatcgcagcagaaagtg
atgcgcggcgtggcatcgctctgtatcggcggcggtgaagccacggccatcgcgattgaa
attccgctgccggaagcctga

DBGET integrated database retrieval system