KEGG   Vibrio furnissii: vfu_B01463Help
Entry
vfu_B01463        CDS       T01680                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vfu  Vibrio furnissii
Pathway
vfu00010  Glycolysis / Gluconeogenesis
vfu00020  Citrate cycle (TCA cycle)
vfu00620  Pyruvate metabolism
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01120  Microbial metabolism in diverse environments
vfu01130  Biosynthesis of antibiotics
vfu01200  Carbon metabolism
Module
vfu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    vfu_B01463
   00020 Citrate cycle (TCA cycle)
    vfu_B01463
   00620 Pyruvate metabolism
    vfu_B01463
Enzymes [BR:vfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     vfu_B01463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 DUF3008 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADT89639
UniProt: F0M0V6
Position
2:complement(1545423..1546574)
Genome map
AA seq 383 aa AA seqDB search
MKSFMLPDLGEGLAESEIVEWHVNVGDVVKVDQVVLTVETAKATVEVPAPYAGKIISRYG
NEGDVINIGSLLLEIEELDSAGNAISSPQKKHDAATVVGNVSHQSHNVDVDDFWVGSSEQ
ANPTKKSLSALPAARLLAQRLGVDLQRLQGTGPDGLIVESDVQNAADQQIPGTEVLKGAR
RTMVNTMTESHLQVAAVTITEEALLTEWKPGEDISIRLIQAIVSACQQEPAMNAWFDAET
MTRCVHSTVNIGIAVDSAHGLYVPVLRRADTFEPQAMREWLDTTVQGIRERKIGREQLQH
ATITLSNFGAIAGIFATPVVSPPQVTIVGAGRIIEKVMIKDEQLMNVKAMPLSITFDHRA
CTGGEAARFARALVQDLQRPSAL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcatttatgttacccgacctcggtgaggggttagccgaatcagaaatcgtcgaa
tggcatgtcaacgtcggcgatgtggtaaaagtcgatcaagtcgtgctgacggtggaaacc
gccaaagccacggttgaagtgcccgcgccatacgcgggtaaaatcatcagtcgttacggc
aatgaaggggatgtgatcaacatcggcagtttgcttctggaaattgaagagctcgacagc
gccggcaacgccatatccagtccccagaaaaaacacgacgcagcgaccgtggtcggcaat
gtctcccaccagtcacacaatgtggatgtggatgacttctgggtgggcagcagcgagcag
gccaatccgacgaagaaatcactctccgccctacccgccgcccgcctgctggcgcagcgt
ctcggcgtggatttacagcgtttacaaggcaccggccccgatggtttgattgtcgagagt
gatgtgcagaatgccgccgaccaacagatccccggcacggaagtgctcaaaggcgcacga
agaaccatggtcaacaccatgactgaatcgcacctgcaagttgcggcggtcaccatcacc
gaagaagccctgctgaccgagtggaagccgggtgaagacatctcgattcgcctcattcag
gcgattgtttctgcctgccagcaagagccagcaatgaacgcttggtttgatgccgaaacc
atgacccgttgcgtgcacagcaccgtcaatatcggcattgcagtcgacagcgcccacggc
ttatatgtgccagtactgcgccgcgcggatacatttgaaccccaagcgatgcgtgaatgg
ctcgataccaccgtgcaagggattcgcgaacgcaaaattggccgcgaacagttacagcac
gctaccatcacgttatccaactttggcgcgattgctgggatcttcgcgacgccagtcgtg
tcaccgcctcaggtcaccattgttggtgccggtcgcatcatcgaaaaagtgatgatcaaa
gacgagcaattgatgaacgtgaaagcgatgccgctgtcgattaccttcgaccaccgtgcc
tgcacaggcggtgaagcggcccgttttgcccgcgcactggtgcaagatctgcaacgtcca
agcgcgctgtaa

DBGET integrated database retrieval system