KEGG   Viruses: 11027185Help
Entry
11027185          CDS       T40000                                 

Gene name
POLY, HCV3_gp1
Definition
(RefSeq) Hepatitis C virus genotype 3; polyprotein
  KO
K19358  HCV polyprotein
Taxonomy
TAX:356114
  Lineage
Viruses; ssRNA viruses; Flaviviridae; Hepacivirus; Hepacivirus A
Taxonomy
Organism
vg  Viruses (Hepacivirus C)
SSDB OrthologParalogGFIT
Motif
Pfam: HCV_NS1 RdRP_3 HCV_env HCV_NS5a_C HCV_NS2 HCV_NS4b Peptidase_S29 HCV_capsid HCV_core HCV_NS5a_1b HCV_NS5a_1a HCV_NS4a HCV_NS5a Flavi_DEAD ResIII Helicase_C
Motif
Other DBs
NCBI-GeneID: 11027185
NCBI-ProteinID: YP_001469631
RS: NC_009824
UniProt: Q81258
Position
NC_009824:340..9405
AA seq 3021 aa AA seqDB search
MSTLPKPQRKTKRNTIRRPQDVKFPGGGQIVGGVYVLPRRGPRLGVRATRKTSERSQPRG
RRQPIPKARRSEGRSWAQPGYPWPLYGNEGCGWAGWLLSPRGSRPSWGPNDPRRRSRNLG
KVIDTLTCGFADLMGYIPLVGAPVGGVARALAHGVRALEDGINFATGNLPGCSFSIFLLA
LFSCLIHPAASLEWRNTSGLYVLTNDCSNSSIVYEADDVILHTPGCVPCVQDGNTSTCWT
PVTPTVAVRYVGATTASIRSHVDLLVGAATMCSALYVGDMCGAVFLVGQAFTFRPRRHQT
VQTCNCSLYPGHLSGHRMAWDMMMNWSPAVGMVVAHVLRLPQTLFDIMAGAHWGILAGLA
YYSMQGNWAKVAIIMVMFSGVDAHTYTTGGTASRHTQAFAGLFDIGPQQKLQLVNTNGSW
HINSTALNCNESINTGFIAGLFYYHKFNSTGCPQRLSSCKPITFFRQGWGPLTDANITGP
SDDRPYCWHYAPRPCDIVPASSVCGPVYCFTPSPVVVGTTDARGVPTYTWGENEKDVFLL
KSQRPPSGRWFGCSWMNSTGFLKTCGAPPCNIYGGEGNPHNESDLFCPTDCFRKHPETTY
SRCGAGPWLTPRCMVDYPYRLWHYPCTVDFRLFKVRMFVGGFEHRFTAACNWTRGERCDI
EDRDRSEQHPLLHSTTELAILPCSFTPMPALSTGLIHLHQNIVDVQYLYGVGSGMVGWAL
KWEFVILVFLLLADARVCVALWLMLMISQTEAALENLVTLNAVAAAGTHGIGWYLVAFCA
AWYVRGKLVPLVTYSLTGLWSLALLVLLLPQRAYAWSGEDSATLGAGVLVLFGFFTLSPW
YKHWIGRLMWWNQYTICRCESALHVWVPPLLARGSRDGVILLTSLLYPSLIFDITKLLMA
VLGPLYLIQATITTTPYFVRAHVLVRLCMLVRSVIGGKYFQMIILSIGRWFNTYLYDHLA
PMQHWAAAGLKDLAVATEPVIFSPMEIKVITWGADTAACGDILCGLPVSARLGREVLLGP
ADDYREMGWRLLAPITAYAQQTRGLLGTIVTSLTGRDKNVVTGEVQVLSTATQTFLGTTV
GGVIWTVYHGAGSRTLAGAKHPALQMYTNVDQDLVGWPAPPGAKSLEPCACGSSDLYLVT
RDADVIPARRRGDSTASLLSPRPLACLKGSSGGPVMCPSGHVAGIFRAAVCTRGVAKSLQ
FIPVETLSTQARSPSFSDNSTPPAVPQSYQVGYLHAPTGSGKSTKVPAAYVAQGYNVLVL
NPSVAATLGFGSFMSRAYGIDPNIRTGNRTVTTGAKLTYSTYGKFLADGGCSGGAYDVII
CDECHAQDATSILGIGTVLDQAETAGVRLTVLATATPPGSITVPHSNIEEVALGSEGEIP
FYGKAIPIALLKGGRHLIFCHSKKKCDEIASKLRGMGLNAVAYYRGLDVSVIPTTGDVVV
CATDALMTGFTGDFDSVIDCNVAVEQYVDFSLDPTFSIETRTAPQDAVSRSQRRGRTGRG
RLGTYRYVASGERPSGMFDSVVLCECYDAGCSWYDLQPAETTVRLRAYLSTPGLPVCQDH
LDFWESVFTGLTHIDAHFLSQTKQQGLNFSYLTAYQATVCARAQAPPPSWDEMWKCLVRL
KPTLHGPTPLLYRLGPVQNETCLTHPITKYLMACMSADLEVTTSTWVLLGGVLAALAAYC
LSVGCVVIVGHIELEGKPALVPDKEVLYQQYDEMEECSQAAPYIEQAQVIAHQFKEKILG
LLQRATQQQAVIEPIVTTNWQKLEAFWHKHMWNFVSGIQYLAGLSTLPGNPAVASLMAFT
ASVTSPLTTNQTMFFNILGGWVATHLAGPQSSSAFVVSGLAGAAIGGIGLGRVLLDILAG
YGAGVSGALVAFKIMGGECPTAEDMVNLLPAILSPGALVVGVICAAILRRHVGPGEGAVQ
WMNRLIAFASRGNHVSPTHYVPESDAAARVTALLSSLTVTSLLRRLHQWINEDYPSPCSD
DWLRTIWDWVCSVLADFKAWLSAKIMPALPGLPFISCQKGYKGVWRGDGVMSTRCPCGAA
ITGHVKNGSMRLAGPRTCANMWHGTFPINEYTTGPSTPCPSPNYTRALWRVAANSYVEVR
RVGDFHYITGATEDELKCPCQVPAAEFFTEVDGVRLHRYAPPCKPLLRDDITFMVGLHSY
TIGSQLPCEPEPDVSVLTSMLRDPSHITAETAARRLARGSPPSEASSSASQLSAPSLKAT
CQTHRPHPDAELVDANLLWRQEMGSNITRVESETKVVVLDSFEPLRAETDDVEPSVAAEC
FKKPPKYPPALPIWARPDYNPPLLDRWKAPDYVPPTVHGCALPPRGAPPVPPPRRKRTIQ
LDGSNVSAALAALAEKSFPSSKPQEENSSSSGVDTQSSTTSKVPPSPGGESDSESCSSMP
PLEGEPGDPDLSCDSWSTVSDSEEQSVVCCSMSYSWTGALITPCSAEEEKLPISPLSNSL
LRHHNLVYSTSSRSASQRQKKVTFDRLQVLDDHYKTALKEVKERASRVKARMLTIEEACA
LVPPHSARSKFGYSAKDVRSLSSRAINQIRSVWEDLLEDTTTPIPTTIMAKNEVFCVDPA
KGGRKPARLIVYPDLGVRVCEKRALYDVIQKLSIETMGPAYGFQYSPQQRVERLLKMWTS
KKTPLGFSYDTRCFDSTVTEQDIRVEEEIYQCCNLEPEARKVISSLTERLYCGGPMFNSK
GAQCGYRRCRASGVLPTSFGNTITCYIKATAAAKAANLRNPDFLVCGDDLVVVAESDGVD
EDRAALRAFTEAMTRYSAPPGDAPQATYDLELITSCSSNVSVARDDKGRRYYYLTRDATT
PLARAAWETARHTPVNSWLGNIIMYAPTIWVRMVMMTHFFSILQSQEILDRPLDFEMYGA
TYSVTPLDLPAIIERLHGLSAFTLHSYSPVELNRVAGTLRKLGCPPLRAWRHRARAVRAK
LIAQGGKAKICGLYLFNWAVRTKTNLTPLPAAGQLDLSSWFTVGVGGNDIYHSVSRARTR
HLLLCLLLLTVGVGIFLLPAR
NT seq 9066 nt NT seq  +upstreamnt  +downstreamnt
atgagcacacttcctaaacctcaaagaaaaaccaaaagaaacaccatccgtcgcccacag
gacgtcaagttcccgggtggcggacagatcgttggtggagtatacgtgttgccgcgcagg
ggcccacgattgggtgtgcgcgcgacgcgtaaaacttctgaacggtcacagcctcgcgga
cgacgacagcctatccccaaggcgcgtcggagcgaaggccggtcctgggctcagcccggg
tacccttggcccctctatggtaacgagggctgcgggtgggcagggtggctcctgtcccca
cgcggctcccgtccatcctggggcccaaatgacccccggcggaggtcccgcaatttgggt
aaagtcatcgataccctaacgtgcggattcgccgacctcatggggtacatcccgctcgtc
ggcgctcctgtaggaggcgtcgcaagagccctcgcgcatggcgtgagggcccttgaagac
gggataaatttcgcaacagggaacttgcccggttgctccttttctatcttccttcttgct
ctgttctcttgcttaattcatccagcagccagtctagagtggcggaatacgtctggcctc
tacgtccttaccaacgactgttccaatagcagtattgtgtatgaggccgatgatgtcatt
ctgcacacacccggctgtgtaccttgtgtccaggacggcaatacatctacgtgctggacc
ccagtgacacctacagtggcagtcaggtacgtcggagcaactactgcttcgatacgcagt
catgtggacctattagtaggcgcggccacgatgtgctctgcgctctacgtgggtgatatg
tgtggggctgtctttctcgtgggacaagccttcacgttcagacctcgacgccatcaaacg
gtccagacctgtaactgctcgctgtacccaggccatctttcaggacatcgaatggcttgg
gatatgatgatgaattggtcccccgctgtgggtatggtggtggcgcatgtcctgcgttta
ccccagaccttgttcgacataatggccggggcccattggggcatcttggcgggcctggcc
tattactccatgcagggcaactgggccaaggtcgcaatcatcatggttatgttctcaggg
gtcgatgcccacacatataccaccggtggcactgcatctcgtcatacccaagcgtttgct
ggtctttttgacataggcccccaacagaaactgcagctggtcaacaccaatggctcgtgg
cacatcaacagtactgccctaaattgcaatgagtccataaacaccgggtttatagctggg
ttgttttattaccataagttcaactctactggatgtcctcaaaggctcagcagctgcaag
cccatcactttcttcaggcagggatggggccccttaacagatgctaacatcaccggtcct
tctgatgacagaccatactgctggcactacgcacctagaccttgtgacattgtcccggca
tcaagtgtctgcggccctgtgtactgcttcacaccatcgccagtggtcgtaggcactact
gatgccaggggcgtgccaacctacacctggggtgagaatgagaaagatgtgttcctgctg
aagtcccagcggcctcccagtggtcggtggtttgggtgctcgtggatgaactccacgggg
tttctcaagacgtgcggagctcccccctgtaacatctatgggggcgaggggaatccccac
aatgaatcagatcttttctgccccactgactgcttcaggaaacatcccgagaccacgtac
agccggtgtggtgcagggccctggttgacacctcgttgcatggttgactacccataccgg
ctttggcattacccatgtacagtcgatttcagattgttcaaggtgaggatgtttgtgggt
gggtttgaacatcgatttaccgccgcttgcaactggaccaggggggagcgctgcgatatc
gaggatcgtgaccgcagtgagcaacatccgctgctgcattcaacaactgagcttgctata
ctgccttgctctttcacgcccatgcctgcgctgtcaacaggtctgatacacctccaccaa
aacatcgtggatgtccaatacctttatggcgttggatctggcatggtgggatgggcgctg
aaatgggagttcgtcatcctcgttttcctccttctggcggacgcacgcgtgtgcgttgcc
ctttggctgatgctgatgatatcacagacagaagcagccttggagaacctggtcacgctg
aacgccgtcgctgctgctgggacacatggtatcggctggtacctggtagctttttgcgcg
gcgtggtacgtgcggggtaaactcgtcccgctggtgacctacagcctgacgggtctttgg
tccctagcattgctcgtcctcttgctcccccaacgtgcgtatgcttggtcgggtgaagac
agcgccactcttggcgctggggtcttggtcctcttcggcttctttaccttgtcaccctgg
tataagcattggatcggccgcctcatgtggtggaaccagtacaccatatgcagatgcgag
tccgcccttcacgtgtgggttccccccttactcgcacgcgggagtagggatggtgtcatc
ctgctaacaagcctgctttatccatccttaatttttgacatcactaagctgctgatggca
gtattgggcccattatacttaatacaggctaccattactaccaccccctactttgtgcgt
gcgcatgtactggtccgcctttgcatgctcgtgcgctccgtgataggggggaaatacttc
cagatgatcatactgagcattggcagatggttcaacacctacctatacgaccacctagcg
ccaatgcaacactgggccgctgctggtctcaaagacctagcagtggccactgaacctgta
atatttagtcccatggaaatcaaggtcatcacctggggtgcggatacagcggcttgcgga
gatattctttgcgggctgcccgtctctgcacgattaggccgtgaggtgttgttgggacct
gctgatgactatcgggagatgggctggcgtctgttggccccgattacagcatacgcccag
caaactaggggccttcttgggactattgtgactagcttgactggcagagacaagaacgtg
gtgaccggtgaagtgcaggtgctttctacggctacccagaccttcctaggtacaacagta
gggggggttatatggactgtttatcatggagcaggttcgagaacgctcgcgggcgccaaa
catcccgcgctccaaatgtacacaaatgtagatcaggacctcgttgggtggccagcccct
ccaggggccaagtctcttgaaccgtgcgcctgcgggtcttcagacttatacttggttacc
cgcgatgccgatgtcatccctgctcggcgcagaggggactccacagcgagcttgctcagt
cctaggcctctcgcctgtctcaagggttcctctggaggtcccgttatgtgcccttcgggg
catgttgcggggatctttagggctgctgtgtgcaccagaggtgtagcaaaatccctacag
ttcataccagtggaaacccttagcacgcaggctaggtctccatctttctctgacaattca
actcctcctgctgttccacagagctatcaagtaggatacctccatgccccgaccggcagc
ggtaagagcacaaaggtcccggccgcttatgtagcacaaggatataatgtcctcgtacta
aatccatcggtggcggccacattaggcttcggctccttcatgtcgcgtgcctatgggatc
gaccccaacatccgcactgggaaccgcaccgttacaactggtgctaaactgacctattcc
acctacggtaagtttctcgcggacgggggttgctccgggggggcatatgatgtgattatc
tgtgatgaatgtcatgcccaagacgctactagcatattgggtataggcacggtcttagat
caggctgagacggctggggtgaggctgacggttttagcgacagcaactcccccaggcagc
atcactgtgccgcattctaacatcgaagaagtggccctgggctctgaaggtgagatccct
ttctacggtaaggctataccgatagccctgctcaagggggggaggcaccttatcttttgc
cattccaagaaaaaatgtgatgagatagcgtccaaactaagaggcatggggctcaacgct
gtagcatactataggggtctcgatgtgtccgtcataccaacaacaggagacgtcgtagtt
tgcgctactgacgccctcatgactggattcaccggggacttcgattctgtcatagattgc
aacgtggctgttgaacagtacgttgacttcagcctggaccccaccttttccattgagacc
cgcactgctccccaagatgcggtttcccgcagccaacgtcgcggccgaacgggtcgaggt
agactcggtacgtaccgatatgtcgcctccggtgaaagaccgtctggaatgtttgactcg
gtcgtcctctgtgagtgctatgacgcgggctgctcatggtacgatctgcagcccgctgag
accacagttagactgagagcttacttgtccacacccgggttacccgtctgccaagaccat
ttagacttttgggagagcgtcttcactggactaactcacatagatgcccactttctgtca
cagactaagcagcagggacttaacttctcgtacctaactgcctaccaagccactgtgtgc
gcccgcgcgcaggctcctcccccaagttgggacgagatgtggaagtgtctcgtgcggctt
aagccaacactacatggacctacgccccttctatatcggctggggcctgtccaaaatgaa
acctgcttgacacaccccatcacaaaatacctcatggcatgcatgtcagccgatctggaa
gtaaccaccagcacctgggtgttgctcggaggggtcctcgcagccctagcggcctactgc
ttgtcagtcggctgcgttgtgattgtgggtcatattgagctggagggcaagccagcactc
gttccagacaaagaggtgttgtatcaacaatacgatgagatggaggagtgctcacaagct
gccccatatatcgaacaagctcaggtaatagcccaccagttcaaggaaaaaatccttgga
ttgctgcagcgagccacccagcaacaagctgtcattgagcccatagtaactaccaactgg
caaaagcttgaggccttctggcacaagcatatgtggaattttgtgagtgggatccaatac
ctagcaggcctctccactttgcctggcaaccctgctgtggcgtctcttatggcgttcact
gcttcagtcaccagtcccctgacgaccaaccaaactatgttttttaacatactcgggggg
tgggttgccacccatttggcagggccccagagctcctccgcgttcgtggtaagcggcttg
gcaggcgctgccatagggggtataggcctgggcagggtcttgcttgacatcctggcagga
tacggagctggtgtctcaggcgccttggtagcttttaagatcatgggaggagaatgcccc
actgctgaggacatggtcaacctgttgcccgccatactatctccgggtgctctcgtcgtc
ggtgtgatatgcgcagccatactgcgccgacacgtaggacctggggagggagcggtacag
tggatgaacaggctcatcgcgttcgcatcccggggcaaccacgtctcaccgacgcactat
gttcccgagagcgatgctgcggcaagggtcaccgcattgctgagttctctaactgtcaca
agtctgctccggcggttacaccagtggatcaatgaagactacccaagcccttgtagcgac
gattggctacgtaccatctgggactgggtttgctcggtgttggccgacttcaaggcatgg
ctctctgctaagattatgccagcgctccctgggctgcccttcatttcctgtcaaaaggga
tacaagggcgtgtggcggggggacggtgtgatgtcaacacgctgtccttgcggggcagca
ataactggccatgtgaagaacgggtccatgcggcttgcagggccgcgtacatgtgctaac
atgtggcacggtactttccccatcaatgagtacaccaccggacccagcacaccttgccca
tcacccaactacactcgcgcactatggcgcgtggctgccaacagctacgttgaggtgcgt
cgggtgggggacttccattacatcacgggggccacagaagatgagctcaagtgtccgtgc
caagtgccggctgctgagttctttactgaagtggatggagtgagacttcaccgctacgcc
cctccatgtaagcccctgttgagagatgatatcactttcatggtagggttgcattcctac
acgataggatctcaactcccctgtgagccagaaccggatgtctctgtgctgacctcgatg
ttgagagacccttcccatatcaccgccgagacggcagcgcgccgccttgcacgcgggtcc
cctccatcagaggcaagctcatccgccagccaactatcagctccgtcgttgaaggccact
tgccagacgcataggcctcatccagacgctgagctagtggacgccaacttgttatggcgg
caagagatgggcagcaacattacacgggtggagtctgagacaaaggttgtggttcttgat
tcgttcgagcctctgagagccgaaactgatgacgtcgagccctcggtggctgcagagtgt
ttcaagaaacctcccaagtatcctccagcccttcctatctgggctagaccggactacaat
cctccactgttggaccgctggaaagcaccggattatgtaccaccaactgtccatggatgt
gccttaccaccacggggcgctccaccggtgcctccccctcggaggaaaaggacaattcag
ctggacggctctaatgtgtccgcggcgctagccgcgctagctgaaaaatcattcccgtcc
tcgaaaccacaggaagagaatagctcatcctccggggtcgacacacagtccagcactact
tccaaggtgcccccttctccgggaggggagtccgactcagagtcatgctcgtctatgcct
cctctcgagggagagccgggcgacccggacttgagttgcgactcttggtccaccgttagt
gacagcgaggagcagagcgtggtctgctgctctatgtcgtattcttggaccggcgccctg
ataacaccatgtagtgctgaggaagagaaactgcccatcagcccactcagcaactccctg
ttgagacatcataacctagtctattcaacgtcgtctagaagcgcttctcagcgtcagaag
aaggttaccttcgatagactgcaggtgctcgacgaccattacaagactgcattaaaggag
gtaaaggagcgagcgtctagggtaaaggctcgcatgctcaccatcgaggaagcgtgcgcg
ctcgtccctcctcactctgcccgatcgaagttcgggtatagtgcgaaggacgttcgctcc
ttgtccagcagggccattaaccagatccgctccgtctgggaggacttgctggaagacacc
acaactccaattccaaccaccatcatggcgaagaacgaggtgttttgcgtggaccccgct
aaagggggccgcaagcccgctcgcctcattgtgtaccctgacctgggggtgcgtgtctgt
gagaaacgcgccctgtatgacgtgatacagaagttgtcaattgagacgatgggtcctgcc
tatggattccaatactcgcctcaacagcgggtcgaacgtctgctgaagatgtggacctca
aagaaaacccccttggggttctcatatgacacccgctgctttgactcaactgtcactgaa
caggacatcagggtggaagaggagatataccaatgctgtaaccttgaaccggaggccagg
aaagtgatctcctccctcacggagcggctttactgcggaggccctatgttcaacagcaag
ggggcccagtgtggttatcgccgttgccgtgccagtggagttctgcctaccagcttcggc
aacacaatcacttgttacatcaaggccacagcggctgcaaaggccgcaaacctccggaac
ccggactttcttgtctgcggagatgatttggtcgtggtggctgagagtgatggcgtcgat
gaggatagagcagccctgagagccttcacggaggctatgaccaggtattctgctccaccc
ggagatgctccacaggccacttacgaccttgagcttatcacatcttgctcctccaacgtc
tccgtggcacgggacgacaaggggaggaggtactattacctcacccgtgatgccactact
cccctagcccgtgcggcttgggaaacagctcgtcacactccagttaactcctggttaggc
aacatcatcatgtacgcgcctaccatctgggtgcgcatggtgatgatgacacactttttc
tccatactccaatcccaggagatacttgatcgcccccttgactttgaaatgtacggggcc
acttattctgtcactccgctggatttaccagcaatcattgaaagactccatggtctaagc
gcgttcacgctccacagttactctccagtagagctcaatagggtcgcggggacactcagg
aagcttgggtgcccccccctacgggcttggagacatcgggcacgagcagtgcgcgccaag
cttatcgcccagggaggaaaggctaaaatatgcggcctttatctctttaattgggcggta
cgcaccaagaccaacctcactccattgccagccgctggccagttggatttgtccagctgg
tttacggttggtgtcggcgggaacgacatttatcacagcgtgtcgcgtgcccgaacccgc
catttgctgctttgcctactcctactaacagtaggggtaggcatctttctcttgccagct
cgatga

DBGET integrated database retrieval system