KEGG   Viruses: 1258547
Entry
1258547           CDS       T40000                                 

Symbol
uvsY, T4p187
Name
(RefSeq) Escherichia virus T4; recombination mediator protein UvsY
Taxonomy
TAX:10665
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Tevenvirinae; Tequatrovirus
Organism
vg  Viruses (Escherichia virus T4)
SSDB
Motif
Pfam: UvsY
Other DBs
NCBI-GeneID: 1258547
NCBI-ProteinID: NP_049799
RS: NC_000866
UniProt: P04537 A0A023ZWF2
Structure
Position
NC_000866:complement(114914..115327)
AA seq 137 aa
MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKAR
LDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSR
GFAIKHIQDMRAFEAGK
NT seq 414 nt   +upstreamnt  +downstreamnt
atgagattagaagatcttcaagaagaattgaagaaagatgtgtttatagattcgactaaa
ttacagtatgaagcagctaataatgtgatgttatatagtaaatggcttaataagcattca
agtattaaaaaggaaatgcttagaattgaagcacagaaaaaagttgctcttaaagctaga
ttagactactactcgggacgaggagatggtgatgaatttagtatggatcgttacgagaaa
tcagaaatgaagacagttctatcagcggataaggatgttttaaaggttgatacctcgttg
cagtattgggggattttattagatttctgtagcggagctcttgatgctattaaatcacgt
ggatttgctattaagcatattcaagacatgcgagcatttgaggctggaaaataa

DBGET integrated database retrieval system