KEGG   Viruses: 1258727
Entry
1258727           CDS       T40000                                 

Gene name
19, T4p168
Definition
(RefSeq) Escherichia virus T4; tail tube protein
Taxonomy
TAX:10665
  Lineage
Viruses; dsDNA viruses; Caudovirales; Myoviridae; Tevenvirinae; Tequatrovirus
Organism
vg  Viruses (Escherichia virus T4)
SSDB
Motif
Pfam: Phage_T4_gp19
Other DBs
NCBI-GeneID: 1258727
NCBI-ProteinID: NP_049781
RS: NC_000866
UniProt: P13333 A0A023ZVZ7
Position
NC_000866:100632..101123
AA seq 163 aa
MFVDDVTRAFESGDFARPNLFQVEISYLGQNFTFQCKATALPAGIVEKIPVGFMNRKINV
AGDRTFDDWTVTVMNDEAHDARQKFVDWQSIAAGQGNEITGGKPAEYKKSAIVRQYARDA
KTVTKEIEIKGLWPTNVGELQLDWDSNNEIQTFEVTLALDYWE
NT seq 492 nt   +upstreamnt  +downstreamnt
atgtttgtagatgatgtaacacgagcgtttgaatctggtgattttgctcgacctaactta
ttccaagtagaaatttcttatcttggacaaaattttacgttccaatgtaaagctactgct
ctaccagctggtattgtagaaaaaattccagtcggatttatgaaccgtaaaattaacgta
gcaggcgatcgtacattcgatgactggactgttacagtaatgaacgatgaagctcatgat
gctcgtcagaagttcgttgattggcaaagcattgctgcggggcaaggaaacgaaattact
ggtggaaaacctgcagagtataaaaagagcgctatcgttcgtcaatatgctcgtgacgct
aaaacagtaacaaaagaaattgaaattaaaggtctgtggcctactaacgtgggtgaactt
caattagattgggattcaaacaatgaaatccaaacttttgaagtaactcttgctctcgat
tattgggaataa

DBGET integrated database retrieval system