KEGG   Viruses: 1258796
Entry
1258796           CDS       T40000                                 

Gene name
pseT, T4p223
Definition
(RefSeq) Escherichia virus T4; AAA family ATPase
Taxonomy
TAX:10665
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Tevenvirinae; Tequatrovirus
Organism
vg  Viruses (Escherichia virus T4)
SSDB
Motif
Pfam: AAA_33 AAA_18 LNS2 Zeta_toxin AAA_22 AAA_24 AAA_28 PNK3P Viral_helicase1 AAA_14 CPT ATPase_2 G-alpha
Other DBs
NCBI-GeneID: 1258796
NCBI-ProteinID: NP_049834
RS: NC_000866
UniProt: P06855
Structure
PDB: 

Position
NC_000866:complement(134002..134907)
AA seq 301 aa
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIV
TGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELV
KRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMNGRGPYD
LEKCDTDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPL
VMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGD
F
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaaaaagattattttgactattggctgtcctggttctggtaagagtacttgggctcgt
gaatttattgctaagaatcccgggttttataatatcaatcgtgatgactatcgccaatct
attatggcgcatgaagaacgcgatgagtacaagtataccaaaaagaaagaaggtatcgta
actggtatgcagtttgatacagctaaaagtattctgtacggtggcgattctgttaaggga
gtaatcatttcagatactaacctgaatcctgaacgtcgcctagcatgggaaacttttgcc
aaagaatacggctggaaagttgaacataaagtgtttgatgttccttggactgaattggtt
aaacgtaactcaaaacgcggaactaaagcagtaccaattgatgttttacgttcaatgtat
aaaagcatgcgagagtatctcggtcttccagtatataatgggactcctggtaaaccaaaa
gcagttatttttgatgttgatggtacactagctaaaatgaatggtcgtggtccttatgac
cttgaaaaatgcgataccgatgttatcaatcctatggttgttgaactgtctaagatgtat
gctcttatgggttatcaaatcgtagtcgtttcaggtcgtgaaagtggaactaaagaagac
ccaacgaaatattatcgtatgacccgtaaatgggttgaggacattgctggcgttccatta
gttatgcaatgtcagcgcgaacaaggcgatacccgtaaagacgatgtagttaaagaagaa
attttctggaaacacattgcaccgcattttgacgtgaaattagctattgatgaccgaact
caagtagttgaaatgtggcgtcgtatcggtgttgaatgctggcaagtcgcttcgggagat
ttttaa

DBGET integrated database retrieval system