KEGG   Viruses: 1260904
Entry
1260904           CDS       T40000                                 

Gene name
Pf3_2
Definition
(RefSeq) Pseudomonas phage Pf3; major coat protein
Taxonomy
TAX:10872
  Lineage
Viruses; ssDNA viruses; Monodnaviria; Loebvirae; Hofneiviricota; Faserviricetes; Tubulavirales; Inoviridae; Tertilicivirus; Pseudomonas virus Pf3
Organism
vg  Viruses (Pseudomonas virus Pf3)
SSDB
Motif
Pfam: Phage_Coat_B TrbC Gram_pos_anchor
Other DBs
NCBI-GeneID: 1260904
NCBI-ProteinID: NP_040652
RS: NC_001418
UniProt: P03623
Structure
PDB: 
1IFP

Position
NC_001418:120..254
AA seq 44 aa
MQSVITDVTGQLTAVQADITTIGGAIIVLAAVVLGIRWIKAQFF
NT seq 135 nt   +upstreamnt  +downstreamnt
atgcaatccgtgattactgatgtgacaggccaactgacagcggtgcaagctgatatcact
accattggtggtgctattattgttctggccgctgttgtgctgggtattcgctggatcaaa
gcgcaattcttttga

DBGET integrated database retrieval system