KEGG   Viruses: 1262827Help
Entry
1262827           CDS       T40000                                 

Gene name
cro, P22gp48
Definition
(RefSeq) Salmonella virus P22; Cro
  KO
K22302  transcriptional repressor of cell division inhibition gene dicB
Taxonomy
TAX:10754
  Lineage
Viruses; dsDNA viruses; Caudovirales; Podoviridae; P22virus
Taxonomy
Organism
vg  Viruses (Salmonella virus P22)
SSDB OrthologParalogGFIT
Motif
Pfam: P22_Cro YdaS_antitoxin HTH_28 HTH_3 BrkDBD Phage_CII HTH_23 DUF739 Phage_terminase
Motif
Other DBs
NCBI-GeneID: 1262827
NCBI-ProteinID: NP_059607
RS: NC_002371
UniProt: P09964 A0A2H4A361
Structure
PDB: 

Position
NC_002371:31744..31929
AA seq 61 aa AA seqDB search
MYKKDVIDHFGTQRAVAKALGISDAAVSQWKEVIPEKDAYRLEIVTAGALKYQENAYRQA
A
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagaaagatgttatcgaccacttcggaacccagcgtgcagtagctaaggcttta
ggcattagcgatgcagcggtctctcagtggaaggaagttatcccagagaaagacgcatac
cgattagagatcgttacagctggcgccctgaagtaccaagaaaacgcttatcgccaagcg
gcgtaa

DBGET integrated database retrieval system