KEGG   Viruses: 14296899
Entry
14296899          CDS       T40000                                 

Gene name
G169_gp16
Definition
(RefSeq) Pseudomonas phage AF; hypothetical protein
Taxonomy
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; unclassified Podoviridae
Organism
vg  Viruses (Pseudomonas phage AF)
SSDB
Motif
Pfam: LPD23 LPD22 Peptidase_M78
Other DBs
NCBI-GeneID: 14296899
NCBI-ProteinID: YP_007237191
RS: NC_019923
UniProt: K4NZ44
Position
NC_019923:13596..20237
AA seq 2213 aa
MIQVPELLKPVDSSAIPQPETPPSKTTQLADAARDFAQSQSQDFVHSMETVSNISPDAYA
KATAVSRYSGVPAKVLHDNADRMNQLLRGNQYAGIYTNYRKTANALRDGNLAAVSQDDLD
QLVRIEGAASDTRFNQQSTGEKLFGAVRQQWVAQRQAGRVADAARLNDIQAQFDRVDLEV
ARAAEAGEQPFPGGDNPTGFGFDYLQATPEQRQQMRERLVGRQTEQLQRAAQDEQTLSDM
PVDPGARRAAELESLGRGSLSATAEALAENPGYAFRTSVGAAATSAEMLAAGAIAGPVAA
AGIGFSGEYQSKLLDVLREAKVNPNDPKAVLRALQDDKLMADAERRASLKAAGTTAVDLV
SMGLASNLLVPSRIAGRQLTRTQRELANLAVQFPVQGIGEGASEAAGQFAAEGKVDAGEV
LLEAVAGAGMSSLDVLAFSNRRLIEGIGDGLRRARETREGQLSLDEMVDASLSSKTRGRE
ADTFGDIAKAQLADTPMETLWIPAEALTRLNQDGKANLPELMLSIPGMTEQFADASARGG
SVAIKTADYLRVFADYHQDLSQSIRTQADGMSPADVEAWTADQEAQLDDLGKIVQQNSPE
TNAYREVVDDLVASGYRRADAEQYASVHLSVLSNLAERTGQALEQIRQQFPLTFTADQAG
PQQGRRLDQFAGQTAWSADMPSLADAEQRIADGDNAEQVRRETGWSQGADGKWRFEIDDS
QAQFAPINDWLDDAEVDGVTLGEALNHPALFAAYPELAQVQIRVNPARRSGGMFVSQPGR
GFVGSYIEIGDPTLYSSDSPAIDVVMHEVQHAIQVREGFATGGSEDAMRADKDQAMADRD
YWRQVADLRREIDSLGEEAGRQAFIDTFERTPTEQQMQDALATDLPQIEQRAADAEQVMR
DIGNPETTYRRLAGEVEARNTERRRTMTAEERQAASPEQTADTPSDQAIVRWNGTEMNSA
AVAGQRLLNQNDNGDARGFITFTPRGEGDRRFQISLGDKRDLSTVLHELGHYYLEVIDQI
STNENAPEQIKDDVSTIRAWLGAEEGDPITTEQHEQFARGFESYLAEGKAPSPELAGAFA
RFKRWLIQIYKDLRRLNVTLTDDVRRVFDRLVATDEQITAAEQVTNALPLFADAAAAGMT
EQEFVAYQNSIDLAHADARDSIEEEIVREEERRRSKWWREESSRVRDEVTEEIDTLPEYA
ALKALRKGQMPDGTDLTIKLNSGELAERYGAKATRKLAFTHARDGQPLDVVGPMLGYDSG
DQLVKALLGAEPRSQVIKRETDQRMLERHGPKSTGEAAERAIDATHNERRAEVLQKELRR
LAQVGNRKNITTQQILKEASRRVMLQRKVRDIQPAEFQRAEAKAGRQSYEAFVNGDLEAA
YEAKQRQLLNFYMYREARKAREQVEDITARMLKYNKASTRERLGKAGHDYLDQIDAVMEQ
YEFRKVSLREVDKRKSFAAWYADQLAMGNEPIVPEFVLNTSQRVNYKDLSLDQLQELDEF
VANVNHLASTKNKLLANKRLKDFEEAKNNLIRAGYANLEKRTPPPVDKNTRTLLERIGDQ
AGELSAALIKMEQVVEWLDGGQVDGPWSTAFFQPFVEAQGAKDQLNRDIAIKMTEIVDAY
TKERGAKVMQQKIHIQSLGQPLTMNAILSAALNTGNASNRKKLLDGGHNGKAWTEQQLNE
ITGNLTKRDWEFVQSMWDLVEELWPSIVQLEKDLHGVPPEKVEATPVVTQHGTFRGGYWP
LVYDTSSSAYAGVQNELGNEGGLFEQGYARATTPKGHTKARVDSFAAPIQLDVEIIASHL
GQVIHDLTHRKAIRDAAKIIGDKQIKQMLIDTLGPAVANQFNPWLQGVANDMVLDSQKGI
DAWTRGAERLRANLAVGFMGFSATTGLQQILGYSQSFEYFSKVGGKRYIFQGMQEFIRHP
FESIEMVNQMSSEMRFRVDNLDRDMRGVLKKISGKSDWLSFVQRLAFKHIGVIQAMVDYP
TWIAGYRHGLDSGLDGEQAIAAGDRAVRLSQMAAGPKDLAAVQRKDGLMRALTIVYSYFN
LLYNRTVDIKRAFSSAKGAADYLNVFERTMFLIAIPAVIGPLVSGQGPGEDEDWRAWASL
KIATYPLLGIPLVRDLASSLESGWAYKGATPIGEVFNTLSKAGAAGKSAAEGKDVDTARA
AGLAIDTIGYSFGLPVAQPKRTVKYLIGVAEGDIEPEGVTDWTRGVIFGPPKK
NT seq 6642 nt   +upstreamnt  +downstreamnt
atgatccaagttcctgagttgctgaaaccggttgattcaagcgcgattccgcagcctgaa
acgcctccgtccaagaccacgcagctggctgatgctgctcgagacttcgcgcagtcgcag
agccaggacttcgtgcacagcatggagacggtttcgaatatcagccctgatgcttatgcc
aaggcgacggctgtgtcacggtacagcggcgtgccggccaaggtgttgcacgacaacgcc
gaccgtatgaaccagctgctgcgcggcaaccagtatgccggcatctacacgaactaccgg
aagacggccaacgctctgcgtgacggcaacctggcagccgtatcgcaagacgaccttgac
cagctggtgcgcatcgagggcgccgcaagcgacacccggttcaaccagcagagcaccgga
gaaaagctgttcggcgcagttcgccagcagtgggtcgcgcagcggcaggctggccgcgtg
gccgatgctgctcggctgaatgacatccaggcccagttcgatcgggtcgaccttgaggtt
gcccgggcggcagaggccggcgagcagccattccctggcggcgacaatcccaccggcttc
ggcttcgactacctgcaagccacgcctgagcagcgccagcagatgcgcgaacgccttgtt
ggccggcagactgaacaactgcagcgagcggcacaggacgagcagacgctttctgatatg
ccagttgatccaggcgcacgccgagcggctgaactcgaatcgctgggccgtggcagcctg
tcagcaactgctgaggccttggccgagaaccctggttatgccttccgcacatccgtaggt
gctgcggcaacaagcgctgaaatgctggccgcgggcgccatcgctggaccagtcgccgcc
gctggtatcgggttctctggtgagtaccagtcaaagctgttggatgtcctgcgcgaggcc
aaggtaaatccgaacgatccaaaggccgtattgcgcgctctgcaagacgataagctcatg
gccgatgcagagcgacgggcaagcctcaaagccgcaggaacgacggctgtggacctcgtg
agcatgggccttgccagtaacctgctggtgccttctcgcattgctggacgccaactcacc
agaacccagcgcgaactggccaacctggcagttcaattcccagtccaaggtattggcgaa
ggcgcgagcgaggcagccggccagttcgcggctgagggaaaggtcgacgctggcgaagtt
ctccttgaggccgtggccggcgccggcatgtcgtcactcgatgtcctggccttcagcaat
cgtcgcctgatcgaaggtattggcgacggcctgcgccgtgcacgcgagacgcgcgaaggt
caactgtccctggacgaaatggttgatgcctcgttgagcagcaaaacccgcgggcgtgag
gcggacacattcggggatatcgcaaaggcccagctggccgacactccgatggaaaccctg
tggattccagctgaagccctgacgcgcctgaatcaggatggcaaagctaatctccctgag
ttgatgctgtcgatcccgggcatgaccgaacagtttgctgatgcctctgcccggggcggc
agcgttgcaatcaagactgcagactatctgcgcgtcttcgctgactatcaccaagacctc
agccaaagcatacggacccaagctgacggcatgagtcctgcagatgtcgaggcctggact
gcggaccaagaagcacagcttgatgacctcggcaagatcgttcagcagaactcaccggag
accaatgcctaccgcgaagttgtcgatgaccttgttgcatccggctaccgccgcgccgat
gccgagcaatacgccagcgtgcacctgtctgtgctgagcaatcttgccgagcgcaccggt
caggcccttgaacagatccgccagcaattcccgctgaccttcaccgccgatcaggcaggt
ccgcagcaaggtcgccgcctggaccagttcgccggccagaccgcttggtctgctgacatg
ccatcgcttgcagatgccgagcagagaattgcagacggcgacaatgccgagcaggtgcgc
cgggaaacaggatggtcacaaggcgccgacggcaaatggcgattcgagattgacgacagc
caggctcaattcgctccgatcaacgactggcttgatgacgccgaggtcgatggcgtaacg
cttggcgaggcgctaaatcaccctgccctgttcgccgcgtaccctgagctggcgcaggtc
cagatccgagtcaaccccgcccgccgatctggcgggatgttcgtttctcagccaggtcga
ggcttcgtcggctcgtacatcgagatcggcgacccaaccctgtacagctctgattcgccc
gccattgacgttgtgatgcatgaggtgcagcacgccattcaggtgcgcgaaggcttcgct
actggcggctcagaggatgccatgcgcgccgacaaggatcaggcaatggctgatcgtgac
tactggcgccaggtcgcggatcttcgccgggagatcgatagccttggcgaggaagcaggc
cgacaggcattcatcgataccttcgagcgcacgccaaccgagcaacagatgcaggatgcc
ttggccactgaccttccacagatcgagcagcgcgccgccgacgccgagcaggtcatgcgc
gatatcggcaaccctgaaacgacgtatcgtcgcctggcaggtgaggtggaggcccgtaac
accgagcgccgtcgcaccatgaccgcagaagagcgccaagccgccagccctgagcaaacc
gctgatacgccatctgaccaagcaatcgtccgctggaatggcactgaaatgaactcggcg
gccgttgccggccagcgcctgctgaaccagaacgacaacggcgatgcccggggcttcatc
accttcacgccacgtggcgaaggtgaccgtcgattccagatctccttgggcgacaagcgc
gacctgtccacggtcctgcacgaactcggacactactacctcgaagtcattgatcaaatt
tcgaccaatgagaacgcgcctgagcagatcaaggatgacgtttccaccattcgcgcctgg
cttggcgcagaagaaggcgatccgatcaccactgagcaacatgagcagtttgcccgtggc
ttcgaaagctatcttgccgagggtaaagccccaagccctgaactggccggagcgttcgcc
cgcttcaagcgctggctgatccagatctacaaggacctgcgacggctcaacgtcacgttg
actgacgatgtgcggcgtgtgttcgaccgccttgttgctaccgacgaacagatcaccgcc
gccgagcaagtgacgaatgcgctgccgctgttcgctgacgctgccgctgccggaatgacc
gaacaggaattcgtggcctatcagaacagcatcgatctggcccacgccgatgcccgagat
tccatagaggaagagattgtccgagaggaagagcgccggcgttcgaagtggtggcgcgaa
gagtcttcccgggtgcgcgacgaggtaacagaagagatcgatacgctgcccgagtacgca
gccctgaaagccctgcgtaaaggccagatgccggacggtaccgatctgaccatcaagctg
aacagcggcgaactggcagagcgctacggcgccaaggctacccgcaaactggcgttcacc
catgcccgtgatggccagcccctggatgttgtcggaccaatgcttggttatgactctggc
gatcagctggtcaaggccttactgggcgcagaaccacgcagccaggtcatcaagcgtgag
acagaccagcgcatgcttgagcgccatggtccgaaatccaccggtgaagcggcagaacgc
gccatcgatgccactcacaacgagcgccgcgctgaggtcctacagaaggagcttcgccgc
ctggcccaggtcggcaaccgcaagaacatcaccactcagcagatcctcaaggaagcctcg
cgccgggtcatgcttcagcggaaggtgcgcgacattcagcctgcagagttccagcgggca
gaggcaaaggccggtcgccagtcgtatgaggcgttcgtgaatggcgaccttgaagccgcc
tacgaggccaaacagcgccagctgctgaacttctacatgtaccgggaagcacgcaaggcc
cgcgagcaggtagaggacatcaccgcccgcatgctcaagtacaacaaggccagtacccgc
gagcgcttgggaaaggctggccatgactacctggaccagatcgatgccgtcatggagcag
tacgaattccgtaaggtgagccttcgcgaggtcgacaagcgcaagtcattcgccgcgtgg
tacgccgaccagctggccatgggcaatgagccaatcgtccctgagttcgtgctgaatacc
agccagcgcgtcaactacaaagacctgagcctggaccagctgcaagagcttgacgagttc
gtcgccaacgtcaaccacctggccagcactaagaacaagctcctggcgaacaagcgtctg
aaggacttcgaagaggccaagaacaacttgatccgcgccggctacgcgaacctcgagaag
cgcacgccgccaccagtcgacaagaacaccagaacgctgctcgagcgcattggtgatcag
gccggagaactgagcgccgccctgatcaagatggaacaggttgttgaatggcttgatggc
ggacaagtagacggcccgtggtctaccgcattcttccagcctttcgttgaggcccaaggc
gccaaggaccagctcaaccgagacatcgccatcaagatgaccgagatcgtcgacgcctac
accaaagagcgcggcgccaaggtcatgcagcagaagatccatatccagagccttggccag
ccgctgaccatgaacgccatcctttcggctgcgctgaacaccggcaacgccagcaaccgc
aagaagctgctcgacggcgggcacaacgggaaggcctggaccgagcagcagctgaacgag
atcaccggaaatctgaccaagcgtgactgggaattcgtgcagtccatgtgggacttagtc
gaggaactgtggccatcgatcgtgcagctggaaaaggacctgcacggcgttccacctgag
aaggttgaggcaactcctgtcgtaacgcagcacggcaccttccgtggaggctactggccc
ttggtgtacgacaccagcagcagcgcttacgccggcgtgcagaatgaactgggcaacgag
ggtggcctgttcgaacagggctatgcccgggcaaccactccgaagggccacaccaaggcc
cgagtcgattctttcgccgctccgatccagttggacgttgagatcatcgcctctcacctt
ggccaggtcatccacgacctgacgcaccgcaaggccatcagggatgccgcgaagatcatc
ggtgacaagcagatcaaacagatgctgatcgacacccttggcccggcagtggcgaaccag
ttcaacccatggctgcaaggcgttgcgaacgacatggtgttggatagccagaagggcata
gacgcatggacccgaggcgccgagcgcctgcgcgccaacctggctgttggcttcatgggc
ttcagtgccacgaccggtcttcagcagatcctcggttactcgcagtccttcgagtacttc
agcaaggtcggcgggaagcgctacatcttccagggcatgcaggagttcattcggcacccg
ttcgaatcgattgaaatggtcaaccagatgtccagcgagatgcgcttccgcgtggacaac
cttgatcgagacatgcgcggcgtgctcaagaaaatcagcggcaagagcgattggctgtcg
ttcgtgcaacgcctggcgttcaagcacatcggcgtgatccaggcgatggtcgactacccg
acttggattgccgggtaccggcacggcctcgactcaggccttgatggcgaacaagcgatt
gcggccggcgaccgtgcagttcgcctgtcgcagatggcagcagggccgaaagacttggcg
gcagtccagcgcaaggacggcctcatgcgcgccctgaccatcgtatacagctacttcaac
cttctgtacaaccgcacggttgacatcaagcgcgcattctccagcgcgaaaggtgcagcc
gattacttgaatgtcttcgagcgcaccatgttcctgatcgccatcccagccgtgattggc
cctctggtgagcggtcaaggcccaggagaagacgaagactggcgcgcctgggcttcactc
aagatcgctacctatccgttgctcggcattccgcttgttcgggatctggcctccagcctg
gaaagcgggtgggcctacaagggggcaaccccaatcggtgaggtgttcaacacgctgagc
aaggcaggcgcagccggcaaatccgccgcagaaggaaaggatgttgatacagcacgggca
gcaggccttgccatcgacaccattggctactcgttcggcctgccagtggctcaacccaag
cgcacggtcaagtacctgatcggtgttgctgagggtgacatcgagccagaaggggtaact
gactggacgcgcggcgtcatcttcggaccgcctaaaaaatga

DBGET integrated database retrieval system